BLASTX nr result
ID: Angelica23_contig00046458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00046458 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66040.1| hypothetical protein [Beta vulgaris subsp. vulga... 45 4e-09 >emb|CCA66040.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1362 Score = 44.7 bits (104), Expect(2) = 4e-09 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -2 Query: 227 AFRGYDPSYS*RNIRGAKSLLLEGLKWRVG 138 A RGY+PS++ R+I G+KSLLLEGLKW VG Sbjct: 901 ARRGYNPSFTWRSIWGSKSLLLEGLKWCVG 930 Score = 40.8 bits (94), Expect(2) = 4e-09 Identities = 18/46 (39%), Positives = 26/46 (56%) Frame = -1 Query: 138 NGTLIKVWEDVWISREGVLSSQNSLSENDADLRVSDIIDFENGGMN 1 +G I+VWED WI EG ++++ DL+V D+ID G N Sbjct: 931 SGERIRVWEDAWILGEGAHMVPTPQADSNLDLKVCDLIDVARGAWN 976