BLASTX nr result
ID: Angelica23_contig00046125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00046125 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631475.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 >ref|XP_003631475.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Vitis vinifera] gi|297742067|emb|CBI33854.3| unnamed protein product [Vitis vinifera] Length = 767 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -1 Query: 375 DTVTYSILIAAHRRLGHLDRAYEVFSEMGEKGVLPDSSIFKMLD 244 D VTY++LIAAHRR G+LD+A E+ +EM E GVLPD + ML+ Sbjct: 709 DVVTYNVLIAAHRRRGNLDKALEMLNEMKENGVLPDHMTYMMLE 752