BLASTX nr result
ID: Angelica23_contig00046082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00046082 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314911.1| predicted protein [Populus trichocarpa] gi|2... 89 5e-16 ref|XP_003628710.1| Pentatricopeptide repeat-containing protein ... 86 3e-15 ref|XP_002514567.1| pentatricopeptide repeat-containing protein,... 83 2e-14 ref|XP_002267613.1| PREDICTED: putative pentatricopeptide repeat... 82 6e-14 ref|XP_004135421.1| PREDICTED: putative pentatricopeptide repeat... 79 4e-13 >ref|XP_002314911.1| predicted protein [Populus trichocarpa] gi|222863951|gb|EEF01082.1| predicted protein [Populus trichocarpa] Length = 743 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/64 (64%), Positives = 50/64 (78%) Frame = +2 Query: 77 MSTISNHYCSFLKHCCETHKQIEVKKLHGLIIKTLVHAETFLLNNLVNSYNKLGNLSYAR 256 MS SN+Y S LK CCET Q + KKLH LIIK+L + ETFL NNL+N+Y+KLGN++YAR Sbjct: 1 MSNSSNYYSSLLKLCCETRNQTQAKKLHCLIIKSLTNPETFLYNNLINAYSKLGNITYAR 60 Query: 257 KVFD 268 VFD Sbjct: 61 HVFD 64 >ref|XP_003628710.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355522732|gb|AET03186.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 748 Score = 85.9 bits (211), Expect = 3e-15 Identities = 40/63 (63%), Positives = 48/63 (76%) Frame = +2 Query: 80 STISNHYCSFLKHCCETHKQIEVKKLHGLIIKTLVHAETFLLNNLVNSYNKLGNLSYARK 259 S+ SNHYC+ LK CCETH + K LH IIKTL + ETFLLNNL++SY KLG++ YA K Sbjct: 6 SSSSNHYCALLKLCCETHNFTKAKNLHSHIIKTLPYPETFLLNNLISSYAKLGSIPYACK 65 Query: 260 VFD 268 VFD Sbjct: 66 VFD 68 >ref|XP_002514567.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546171|gb|EEF47673.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 515 Score = 83.2 bits (204), Expect = 2e-14 Identities = 41/67 (61%), Positives = 49/67 (73%) Frame = +2 Query: 68 YKMMSTISNHYCSFLKHCCETHKQIEVKKLHGLIIKTLVHAETFLLNNLVNSYNKLGNLS 247 YKM S+ SN Y S LK CCET Q + KKLH IIKTL + E FL NNL+N+Y KLGN++ Sbjct: 2 YKMSSS-SNQYSSLLKFCCETRNQSQAKKLHCHIIKTLANPEPFLYNNLMNAYGKLGNIA 60 Query: 248 YARKVFD 268 YAR +FD Sbjct: 61 YARHLFD 67 >ref|XP_002267613.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930 [Vitis vinifera] gi|297738214|emb|CBI27415.3| unnamed protein product [Vitis vinifera] Length = 743 Score = 81.6 bits (200), Expect = 6e-14 Identities = 38/64 (59%), Positives = 47/64 (73%) Frame = +2 Query: 77 MSTISNHYCSFLKHCCETHKQIEVKKLHGLIIKTLVHAETFLLNNLVNSYNKLGNLSYAR 256 MS+ SN+Y S LK CCE+ Q + KKLH LI+KT+ ETFL NNL+ +Y KLGNL+YA Sbjct: 1 MSSSSNYYASLLKLCCESQNQTQAKKLHCLILKTIKQPETFLSNNLITAYYKLGNLAYAH 60 Query: 257 KVFD 268 VFD Sbjct: 61 HVFD 64 >ref|XP_004135421.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like [Cucumis sativus] gi|449493520|ref|XP_004159329.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like [Cucumis sativus] Length = 743 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/64 (57%), Positives = 47/64 (73%) Frame = +2 Query: 77 MSTISNHYCSFLKHCCETHKQIEVKKLHGLIIKTLVHAETFLLNNLVNSYNKLGNLSYAR 256 MS+ SN+Y + LK CCE + +VKKLH II+TL + ETFL NNL+N+Y KLG+L AR Sbjct: 1 MSSSSNYYTAALKFCCEARNRAQVKKLHCRIIRTLTNPETFLYNNLINTYGKLGDLKNAR 60 Query: 257 KVFD 268 VFD Sbjct: 61 NVFD 64