BLASTX nr result
ID: Angelica23_contig00045937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00045937 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGG19193.1| maternal effect embryo arrest 55-1, partial [Dimo... 69 4e-10 ref|XP_002324973.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 ref|NP_189089.3| Serinc-domain containing serine and sphingolipi... 64 2e-08 ref|XP_002885648.1| TMS membrane family protein [Arabidopsis lyr... 63 3e-08 ref|XP_002281302.1| PREDICTED: probable serine incorporator-like... 63 3e-08 >gb|AGG19193.1| maternal effect embryo arrest 55-1, partial [Dimocarpus longan] gi|456723001|gb|AGG38114.1| maternal effect embryo arrest 55-1 protein [Dimocarpus longan] Length = 398 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +2 Query: 2 GWTSTWVRIVIEWLAACIYIWMVVAPVILKHTRAAE 109 GWTSTWVRIV EWLA C+YIWM+VAPVILKH A+E Sbjct: 360 GWTSTWVRIVNEWLAVCVYIWMLVAPVILKHRYASE 395 >ref|XP_002324973.1| predicted protein [Populus trichocarpa] gi|222866407|gb|EEF03538.1| predicted protein [Populus trichocarpa] Length = 398 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +2 Query: 2 GWTSTWVRIVIEWLAACIYIWMVVAPVILKHTRAAEP 112 GWTS WVRIV EWLA C+Y+WM+VAP++LK R AEP Sbjct: 361 GWTSAWVRIVNEWLAVCVYLWMLVAPILLKIRRTAEP 397 >ref|NP_189089.3| Serinc-domain containing serine and sphingolipid biosynthesis protein [Arabidopsis thaliana] gi|17381270|gb|AAL36053.1| AT3g24470/MXP5_4 [Arabidopsis thaliana] gi|37201996|gb|AAQ89613.1| At3g24470/MXP5_4 [Arabidopsis thaliana] gi|332643379|gb|AEE76900.1| Serinc-domain containing serine and sphingolipid biosynthesis protein [Arabidopsis thaliana] Length = 409 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 2 GWTSTWVRIVIEWLAACIYIWMVVAPVILKHTRAAEPSG 118 GWTSTWVR+V EWLA C+YIWM+VAP+ILK +R P+G Sbjct: 371 GWTSTWVRVVNEWLAVCVYIWMLVAPLILK-SRRQTPTG 408 >ref|XP_002885648.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata] gi|297331488|gb|EFH61907.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata] Length = 409 Score = 62.8 bits (151), Expect = 3e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 2 GWTSTWVRIVIEWLAACIYIWMVVAPVILKHTR 100 GWTSTWVR+V EWLA C+YIWM+VAP+ILK R Sbjct: 371 GWTSTWVRVVNEWLAVCVYIWMLVAPLILKSRR 403 >ref|XP_002281302.1| PREDICTED: probable serine incorporator-like [Vitis vinifera] Length = 397 Score = 62.8 bits (151), Expect = 3e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 2 GWTSTWVRIVIEWLAACIYIWMVVAPVILKHTRAAE 109 GWTSTWVRIV EWLAAC+Y+WM+VAP+I K + E Sbjct: 360 GWTSTWVRIVNEWLAACVYLWMLVAPIIWKSRQTGE 395