BLASTX nr result
ID: Angelica23_contig00045747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00045747 (483 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513832.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002513832.1| conserved hypothetical protein [Ricinus communis] gi|223546918|gb|EEF48415.1| conserved hypothetical protein [Ricinus communis] Length = 183 Score = 56.2 bits (134), Expect = 3e-06 Identities = 21/39 (53%), Positives = 28/39 (71%) Frame = -2 Query: 365 KKNKMDLVCDHCKKKGHSVDQCFKLVGIPDWYVTLKRKQ 249 KK+K + CDHC+ KGH D CFK+ G+PDWY L+ +Q Sbjct: 109 KKDKENKFCDHCRTKGHERDTCFKIHGVPDWYKELREQQ 147