BLASTX nr result
ID: Angelica23_contig00045719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00045719 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002879598.1| hypothetical protein ARALYDRAFT_902735 [Arab... 77 1e-12 dbj|BAE98941.1| putative salt-inducible protein [Arabidopsis tha... 77 1e-12 gb|AAT44969.1| At2g36240 [Arabidopsis thaliana] gi|50198948|gb|A... 77 1e-12 ref|NP_181166.3| pentatricopeptide repeat-containing protein [Ar... 77 1e-12 ref|XP_002528752.1| pentatricopeptide repeat-containing protein,... 75 6e-12 >ref|XP_002879598.1| hypothetical protein ARALYDRAFT_902735 [Arabidopsis lyrata subsp. lyrata] gi|297325437|gb|EFH55857.1| hypothetical protein ARALYDRAFT_902735 [Arabidopsis lyrata subsp. lyrata] Length = 497 Score = 77.0 bits (188), Expect = 1e-12 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +1 Query: 1 PDSVTYNILISGYTREGRRKEGEALVQEMLDKDFIPGIATYNRLMAGLA 147 PD TY++L+SG+T+EGRRKEGE LV EMLDKD +P I TYNRLM GL+ Sbjct: 436 PDETTYHVLVSGFTKEGRRKEGEVLVNEMLDKDMLPDIFTYNRLMDGLS 484 >dbj|BAE98941.1| putative salt-inducible protein [Arabidopsis thaliana] Length = 497 Score = 77.0 bits (188), Expect = 1e-12 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +1 Query: 1 PDSVTYNILISGYTREGRRKEGEALVQEMLDKDFIPGIATYNRLMAGLA 147 PD TY++L+SG+T+EGRRKEGE LV EMLDKD +P I TYNRLM GL+ Sbjct: 436 PDETTYHVLVSGFTKEGRRKEGEVLVNEMLDKDMLPDIFTYNRLMDGLS 484 >gb|AAT44969.1| At2g36240 [Arabidopsis thaliana] gi|50198948|gb|AAT70477.1| At2g36240 [Arabidopsis thaliana] Length = 379 Score = 77.0 bits (188), Expect = 1e-12 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +1 Query: 1 PDSVTYNILISGYTREGRRKEGEALVQEMLDKDFIPGIATYNRLMAGLA 147 PD TY++L+SG+T+EGRRKEGE LV EMLDKD +P I TYNRLM GL+ Sbjct: 318 PDETTYHVLVSGFTKEGRRKEGEVLVNEMLDKDMLPDIFTYNRLMDGLS 366 >ref|NP_181166.3| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75206301|sp|Q9SJN2.1|PP187_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g36240 gi|4510352|gb|AAD21441.1| putative salt-inducible protein [Arabidopsis thaliana] gi|330254126|gb|AEC09220.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 497 Score = 77.0 bits (188), Expect = 1e-12 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +1 Query: 1 PDSVTYNILISGYTREGRRKEGEALVQEMLDKDFIPGIATYNRLMAGLA 147 PD TY++L+SG+T+EGRRKEGE LV EMLDKD +P I TYNRLM GL+ Sbjct: 436 PDETTYHVLVSGFTKEGRRKEGEVLVNEMLDKDMLPDIFTYNRLMDGLS 484 >ref|XP_002528752.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531846|gb|EEF33664.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 371 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/61 (57%), Positives = 44/61 (72%) Frame = +1 Query: 4 DSVTYNILISGYTREGRRKEGEALVQEMLDKDFIPGIATYNRLMAGLAKKSAHQ*QYLLI 183 D +TY L++GYTREG+ KEGE LV EMLDK+FIP +ATYNRLM GL K + Q+ Sbjct: 309 DDMTYYTLVNGYTREGKWKEGEVLVDEMLDKEFIPDLATYNRLMDGLCKSRSSSTQHFTC 368 Query: 184 I 186 + Sbjct: 369 V 369