BLASTX nr result
ID: Angelica23_contig00045611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00045611 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166191.1| PREDICTED: uncharacterized protein LOC101232... 65 8e-09 ref|XP_002523051.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_004166191.1| PREDICTED: uncharacterized protein LOC101232688 [Cucumis sativus] Length = 256 Score = 64.7 bits (156), Expect = 8e-09 Identities = 35/105 (33%), Positives = 64/105 (60%), Gaps = 6/105 (5%) Frame = -1 Query: 303 LENMLKAYMANNDALIQSQAASLRNLENQVGQLANELRNRPHGTLPSDTEKPKNDGN--- 133 +E +++ YM ND L+QSQA S +N+E Q+GQLAN++ R GT+PS+TE P + G+ Sbjct: 1 METLVQEYMQRNDTLLQSQATSTKNMELQMGQLANDIYGRQKGTIPSNTEIPNHGGSLAK 60 Query: 132 AHCKAITLKSGKVLENAEAKAKEGDTST---TKGEGKNAENSGVQ 7 + +T + G+ L + +++ ++++ + G N +S V+ Sbjct: 61 EKWQVVTSRKGRNLSIPKLESERRNSTSIFVVENGGSNQMSSYVK 105 >ref|XP_002523051.1| conserved hypothetical protein [Ricinus communis] gi|223537708|gb|EEF39330.1| conserved hypothetical protein [Ricinus communis] Length = 116 Score = 56.6 bits (135), Expect = 2e-06 Identities = 33/79 (41%), Positives = 49/79 (62%), Gaps = 7/79 (8%) Frame = -1 Query: 306 SLENMLKAYMANN-------DALIQSQAASLRNLENQVGQLANELRNRPHGTLPSDTEKP 148 SLE ++ ++A + D I++Q AS++NLE Q+GQL+ + R TLPS+TE Sbjct: 26 SLEELMMKFIATSENRFQQTDTAIRNQQASIQNLETQIGQLSRMMVERQPDTLPSNTE-- 83 Query: 147 KNDGNAHCKAITLKSGKVL 91 ++ H KAITL+SGK L Sbjct: 84 -SNPTGHAKAITLRSGKEL 101