BLASTX nr result
ID: Angelica23_contig00045594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00045594 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003517982.1| PREDICTED: pentatricopeptide repeat-containi... 114 6e-24 ref|XP_002269694.1| PREDICTED: pentatricopeptide repeat-containi... 113 2e-23 ref|XP_004135453.1| PREDICTED: pentatricopeptide repeat-containi... 112 4e-23 ref|XP_002316137.1| predicted protein [Populus trichocarpa] gi|2... 111 5e-23 ref|XP_002522441.1| pentatricopeptide repeat-containing protein,... 111 7e-23 >ref|XP_003517982.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980-like [Glycine max] Length = 609 Score = 114 bits (286), Expect = 6e-24 Identities = 54/72 (75%), Positives = 63/72 (87%) Frame = +3 Query: 3 KALAMFGELQAKKMEPTYVTMLGVLSSCGLLGALELGKWVHRYVKEHGFDQYVKVNTALI 182 +ALA+F ELQ ++PT VTML LSSC LLGAL+LG+W+H YVK++GFDQYVKVNTALI Sbjct: 219 EALALFRELQESGLKPTDVTMLVALSSCALLGALDLGRWIHEYVKKNGFDQYVKVNTALI 278 Query: 183 DMYAKCGSLDDA 218 DMYAKCGSLDDA Sbjct: 279 DMYAKCGSLDDA 290 >ref|XP_002269694.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980 [Vitis vinifera] gi|296086362|emb|CBI31951.3| unnamed protein product [Vitis vinifera] Length = 595 Score = 113 bits (282), Expect = 2e-23 Identities = 52/72 (72%), Positives = 66/72 (91%) Frame = +3 Query: 3 KALAMFGELQAKKMEPTYVTMLGVLSSCGLLGALELGKWVHRYVKEHGFDQYVKVNTALI 182 +AL++F ELQA+ ++PT VTML VLSSC LLGAL+LGKW+H YVK++GF+++VKV+TALI Sbjct: 205 EALSLFRELQARNLKPTDVTMLSVLSSCALLGALDLGKWMHEYVKKNGFNRFVKVDTALI 264 Query: 183 DMYAKCGSLDDA 218 DMYAKCGSLDDA Sbjct: 265 DMYAKCGSLDDA 276 >ref|XP_004135453.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980-like [Cucumis sativus] gi|449478665|ref|XP_004155385.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980-like [Cucumis sativus] Length = 604 Score = 112 bits (279), Expect = 4e-23 Identities = 52/72 (72%), Positives = 62/72 (86%) Frame = +3 Query: 3 KALAMFGELQAKKMEPTYVTMLGVLSSCGLLGALELGKWVHRYVKEHGFDQYVKVNTALI 182 +AL++F ELQA +EPT VTML V+ SC LLGAL+LGKW+H YVK+ GFD+YVKVNTALI Sbjct: 214 EALSLFRELQASNIEPTDVTMLSVIMSCALLGALDLGKWIHEYVKKKGFDKYVKVNTALI 273 Query: 183 DMYAKCGSLDDA 218 DM+AKCGSL DA Sbjct: 274 DMFAKCGSLTDA 285 >ref|XP_002316137.1| predicted protein [Populus trichocarpa] gi|222865177|gb|EEF02308.1| predicted protein [Populus trichocarpa] Length = 601 Score = 111 bits (278), Expect = 5e-23 Identities = 51/72 (70%), Positives = 64/72 (88%) Frame = +3 Query: 3 KALAMFGELQAKKMEPTYVTMLGVLSSCGLLGALELGKWVHRYVKEHGFDQYVKVNTALI 182 +AL++F +LQA+K++P VT+L VLSSC LLGAL+LGKW+H YVK++G D+YVKVNTALI Sbjct: 211 EALSLFRQLQARKLKPNDVTVLSVLSSCALLGALDLGKWIHEYVKKNGLDKYVKVNTALI 270 Query: 183 DMYAKCGSLDDA 218 DMYAKCGSLD A Sbjct: 271 DMYAKCGSLDGA 282 >ref|XP_002522441.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538326|gb|EEF39933.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 290 Score = 111 bits (277), Expect = 7e-23 Identities = 53/72 (73%), Positives = 63/72 (87%) Frame = +3 Query: 3 KALAMFGELQAKKMEPTYVTMLGVLSSCGLLGALELGKWVHRYVKEHGFDQYVKVNTALI 182 +ALA+F +LQAKK++PT V ML VL SC LGAL+LGKWV+ YVK++GFD+YVKVNTALI Sbjct: 41 EALALFRKLQAKKLKPTDVIMLSVLLSCAFLGALDLGKWVNEYVKKNGFDKYVKVNTALI 100 Query: 183 DMYAKCGSLDDA 218 MYAKCGSLDDA Sbjct: 101 SMYAKCGSLDDA 112