BLASTX nr result
ID: Angelica23_contig00045469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00045469 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK81970.1| required for arbuscular mycorrhization 2 [Medicag... 56 4e-06 ref|XP_003589857.1| ER glycerol-phosphate acyltransferase [Medic... 56 4e-06 ref|XP_002520171.1| ER glycerol-phosphate acyltransferase [Ricin... 55 8e-06 >gb|AFK81970.1| required for arbuscular mycorrhization 2 [Medicago truncatula] gi|388894446|gb|AFK81972.1| required for arbuscular mycorrhization 2 [Medicago truncatula] Length = 526 Score = 55.8 bits (133), Expect = 4e-06 Identities = 29/50 (58%), Positives = 32/50 (64%), Gaps = 2/50 (4%) Frame = -3 Query: 193 LTDKPLEM--QEGYXXXXXXXXXXXKNDKLPKPIIFHDGRLVQKPTPLMA 50 +TD P +EGY +DKLPKPIIFHDGRLVQKPTPLMA Sbjct: 216 VTDAPFMALCKEGYIVPAKPKVTTVTSDKLPKPIIFHDGRLVQKPTPLMA 265 >ref|XP_003589857.1| ER glycerol-phosphate acyltransferase [Medicago truncatula] gi|355478905|gb|AES60108.1| ER glycerol-phosphate acyltransferase [Medicago truncatula] Length = 568 Score = 55.8 bits (133), Expect = 4e-06 Identities = 29/50 (58%), Positives = 32/50 (64%), Gaps = 2/50 (4%) Frame = -3 Query: 193 LTDKPLEM--QEGYXXXXXXXXXXXKNDKLPKPIIFHDGRLVQKPTPLMA 50 +TD P +EGY +DKLPKPIIFHDGRLVQKPTPLMA Sbjct: 194 VTDAPFMALCKEGYIVPAKPKVTTVTSDKLPKPIIFHDGRLVQKPTPLMA 243 >ref|XP_002520171.1| ER glycerol-phosphate acyltransferase [Ricinus communis] gi|223540663|gb|EEF42226.1| ER glycerol-phosphate acyltransferase [Ricinus communis] Length = 504 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Frame = -3 Query: 190 TDKPLEM--QEGYXXXXXXXXXXXKNDKLPKPIIFHDGRLVQKPTPLMA 50 TD P +EGY DKLPKPI+FHDGRLVQKPTPLMA Sbjct: 196 TDAPFMALCKEGYLVPPKPEVRAVTGDKLPKPIVFHDGRLVQKPTPLMA 244