BLASTX nr result
ID: Angelica23_contig00045464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00045464 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN81449.1| hypothetical protein VITISV_011174 [Vitis vinifera] 41 3e-07 >emb|CAN81449.1| hypothetical protein VITISV_011174 [Vitis vinifera] Length = 891 Score = 41.2 bits (95), Expect(2) = 3e-07 Identities = 21/33 (63%), Positives = 22/33 (66%) Frame = -1 Query: 257 PVILFAVLQYGLLLDVIKSTIMSTHLFRPNKHL 159 PV LFA LQY LL DVI ST S LF P KH+ Sbjct: 856 PVSLFASLQYPLLADVINSTYGSRFLFEPRKHM 888 Score = 38.1 bits (87), Expect(2) = 3e-07 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -3 Query: 357 SIATMMIAFTASFFLLYVKSMKWIPVLVTALA 262 SI TMM+ FT +FF++Y W+P+L+ A Sbjct: 822 SIITMMVTFTITFFIVYHHGFAWVPILIALFA 853