BLASTX nr result
ID: Angelica23_contig00045345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00045345 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACH54085.1| putative chlorophyll b reductase [Nicotiana tabacum] 61 1e-07 >gb|ACH54085.1| putative chlorophyll b reductase [Nicotiana tabacum] Length = 506 Score = 60.8 bits (146), Expect = 1e-07 Identities = 41/116 (35%), Positives = 63/116 (54%), Gaps = 5/116 (4%) Frame = +1 Query: 1 RQVAMWDPIPLKGRRNYMLQVQXXXXXXXXXXXXVGHDMKEMASRRVLKKGNRIKSERGV 180 R V WDP+ +KGRR ++Q + S KG+ IK + + Sbjct: 34 RVVTTWDPLIVKGRRKIVVQ-----------------PCRSFKSEDEYVKGSEIK--KPM 74 Query: 181 YKLLGSLKSTMSRLS--NLHTDEKF---VEDLEDNLSSMALHVGRYIVTMMSTGVI 333 KL+G+++S + S +L T+ KF +E LE+ L +AL++GRYI+TMMSTGV+ Sbjct: 75 NKLVGAIRSAVWSCSKPSLRTENKFREAIEKLEERLFLLALYLGRYIITMMSTGVV 130