BLASTX nr result
ID: Angelica23_contig00045171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00045171 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234580.1| atypical receptor-like kinase 1 precursor [S... 63 2e-08 ref|XP_003530064.1| PREDICTED: probable inactive receptor kinase... 55 5e-06 >ref|NP_001234580.1| atypical receptor-like kinase 1 precursor [Solanum lycopersicum] gi|222431077|gb|ACM50508.1| atypical receptor-like kinase 1 [Solanum lycopersicum] Length = 605 Score = 63.2 bits (152), Expect = 2e-08 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -1 Query: 121 KGRTLQWNSLESTPCSWKGITCDFNISGVVQLRLPGAGLS 2 +GRTL+WN+ S PCSW+G+TCD I+ V++LRLPG GLS Sbjct: 38 RGRTLRWNTTNSIPCSWEGVTCDTTINRVIELRLPGYGLS 77 >ref|XP_003530064.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Glycine max] Length = 684 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/82 (35%), Positives = 41/82 (50%) Frame = -1 Query: 247 QTLQKMLHIYILVFILSPSFFPAGFSXXXXXXXXXXXXXXAVKGRTLQWNSLESTPCSWK 68 Q Q + + ++F FFP+ FS AV+GRTL WN+ +PC+W Sbjct: 3 QHSQTLFATFTIIFFAF--FFPSTFSDISSERAALLALRSAVRGRTLLWNATAPSPCAWP 60 Query: 67 GITCDFNISGVVQLRLPGAGLS 2 G+ CD + VV+L LP LS Sbjct: 61 GVQCDVANASVVELHLPAVALS 82