BLASTX nr result
ID: Angelica23_contig00045157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00045157 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534237.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002534237.1| conserved hypothetical protein [Ricinus communis] gi|223525657|gb|EEF28144.1| conserved hypothetical protein [Ricinus communis] Length = 106 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/53 (52%), Positives = 33/53 (62%) Frame = +3 Query: 6 VTFNPGDKRYTSTQGTPGHGYENCLPKGFRRNSAPSRYINDQTFGSSLCSSIK 164 V F P K +G G ENCLPKGF R SAPSRYIN T G+++CS+ K Sbjct: 51 VAFRP--KTTHGRKGFRGRDVENCLPKGFHRTSAPSRYINYDTLGATMCSTGK 101