BLASTX nr result
ID: Angelica23_contig00045033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00045033 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_849378.2| transducin/WD40 domain-containing protein-like ... 80 1e-13 ref|NP_193167.3| transducin/WD40 domain-containing protein-like ... 80 1e-13 ref|XP_002528824.1| conserved hypothetical protein [Ricinus comm... 78 7e-13 ref|XP_003536836.1| PREDICTED: uncharacterized protein LOC100809... 75 4e-12 ref|XP_003519947.1| PREDICTED: uncharacterized protein LOC100785... 75 4e-12 >ref|NP_849378.2| transducin/WD40 domain-containing protein-like protein [Arabidopsis thaliana] gi|332658015|gb|AEE83415.1| transducin/WD40 domain-containing protein-like protein [Arabidopsis thaliana] Length = 920 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -1 Query: 265 QSCSSDYGIMQKVRDVIGPDDMYSPSFDYLGSRVLLISRDRPAMWRYLL 119 Q +SDYG +Q VR++IGP+DMY PSFDY G RVLLISRDRPA+WRYLL Sbjct: 872 QPLTSDYGSVQTVREIIGPNDMYCPSFDYSGCRVLLISRDRPALWRYLL 920 >ref|NP_193167.3| transducin/WD40 domain-containing protein-like protein [Arabidopsis thaliana] gi|332658016|gb|AEE83416.1| transducin/WD40 domain-containing protein-like protein [Arabidopsis thaliana] Length = 893 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -1 Query: 265 QSCSSDYGIMQKVRDVIGPDDMYSPSFDYLGSRVLLISRDRPAMWRYLL 119 Q +SDYG +Q VR++IGP+DMY PSFDY G RVLLISRDRPA+WRYLL Sbjct: 845 QPLTSDYGSVQTVREIIGPNDMYCPSFDYSGCRVLLISRDRPALWRYLL 893 >ref|XP_002528824.1| conserved hypothetical protein [Ricinus communis] gi|223531736|gb|EEF33558.1| conserved hypothetical protein [Ricinus communis] Length = 919 Score = 78.2 bits (191), Expect = 7e-13 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = -1 Query: 268 MQSCSSDYGIMQKVRDVIGPDDMYSPSFDYLGSRVLLISRDRPAMWRYL 122 +QS ++D Q V+DVIGPDD+YSPSFDYL SRVLLISRDRPA+WR+L Sbjct: 870 VQSVTADQSCTQNVKDVIGPDDLYSPSFDYLSSRVLLISRDRPALWRHL 918 >ref|XP_003536836.1| PREDICTED: uncharacterized protein LOC100809470 [Glycine max] Length = 725 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -1 Query: 250 DYGIMQKVRDVIGPDDMYSPSFDYLGSRVLLISRDRPAMWRYLL 119 DY Q R+VIGPDDMY PSFDYLGSR LLISRDRPAMWR+L+ Sbjct: 681 DYSSDQSFREVIGPDDMYCPSFDYLGSRALLISRDRPAMWRHLI 724 >ref|XP_003519947.1| PREDICTED: uncharacterized protein LOC100785231 [Glycine max] Length = 730 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -1 Query: 250 DYGIMQKVRDVIGPDDMYSPSFDYLGSRVLLISRDRPAMWRYLL 119 DY Q R+VIGPDDMY PSFDYLGSR LLISRDRPAMWR+L+ Sbjct: 686 DYSSDQSFREVIGPDDMYCPSFDYLGSRALLISRDRPAMWRHLI 729