BLASTX nr result
ID: Angelica23_contig00044935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00044935 (394 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64316.1| hypothetical protein VITISV_027915 [Vitis vinifera] 59 4e-07 ref|XP_002270938.2| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 ref|XP_003609609.1| Pentatricopeptide repeat-containing protein ... 57 1e-06 ref|XP_003635554.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 ref|XP_003550529.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >emb|CAN64316.1| hypothetical protein VITISV_027915 [Vitis vinifera] Length = 841 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/63 (39%), Positives = 46/63 (73%) Frame = +2 Query: 197 VSALLEKTLTVKQIKQIQALVLINGLNYVERLLVHRLLDSSCSYNRDTSKYIQLILHHMQ 376 +S L +L+VKQ KQ+ AL+LI+GL+++E +L ++L S+ +Y+ ++Y+ +LHH + Sbjct: 3 ISKLSTISLSVKQAKQVHALILIHGLSHLEPILARQILJSASNYSATVAQYVHSVLHHSK 62 Query: 377 NPD 385 +PD Sbjct: 63 SPD 65 >ref|XP_002270938.2| PREDICTED: pentatricopeptide repeat-containing protein At4g22760-like [Vitis vinifera] Length = 580 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/62 (40%), Positives = 45/62 (72%) Frame = +2 Query: 200 SALLEKTLTVKQIKQIQALVLINGLNYVERLLVHRLLDSSCSYNRDTSKYIQLILHHMQN 379 S L +L+VKQ KQ+ AL+LI+GL+++E +L ++L S+ +Y+ ++Y+ +LHH ++ Sbjct: 8 SKLSTISLSVKQAKQVHALILIHGLSHLEPILARQILISASNYSATVAQYVHSVLHHSKS 67 Query: 380 PD 385 PD Sbjct: 68 PD 69 >ref|XP_003609609.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355510664|gb|AES91806.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 576 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/64 (40%), Positives = 41/64 (64%) Frame = +2 Query: 194 KVSALLEKTLTVKQIKQIQALVLINGLNYVERLLVHRLLDSSCSYNRDTSKYIQLILHHM 373 K++ L++K TVK KQI A ++ N L ++E + +HR+L + + S YI ILHH+ Sbjct: 5 KLTTLMKKCSTVKHAKQIHAQIITNNLTHLEPIFIHRILLCDITNYKTISNYILSILHHL 64 Query: 374 QNPD 385 +NPD Sbjct: 65 RNPD 68 >ref|XP_003635554.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760-like [Vitis vinifera] gi|296083555|emb|CBI23551.3| unnamed protein product [Vitis vinifera] Length = 580 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/62 (40%), Positives = 45/62 (72%) Frame = +2 Query: 200 SALLEKTLTVKQIKQIQALVLINGLNYVERLLVHRLLDSSCSYNRDTSKYIQLILHHMQN 379 S L +L+VKQ KQ+ AL+LI+GL+++E +L ++L S+ +Y+ ++Y+ +LHH ++ Sbjct: 8 SKLSTISLSVKQAKQVHALILIHGLSHLEPILARQILLSASNYSATVAQYVHSVLHHSKS 67 Query: 380 PD 385 PD Sbjct: 68 PD 69 >ref|XP_003550529.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760-like [Glycine max] Length = 576 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/64 (42%), Positives = 39/64 (60%) Frame = +2 Query: 194 KVSALLEKTLTVKQIKQIQALVLINGLNYVERLLVHRLLDSSCSYNRDTSKYIQLILHHM 373 K+ L++K TVKQ KQI A +LING ++ LL+HR+L + R + Y +LHH+ Sbjct: 5 KLITLMKKCSTVKQAKQIHAHILINGFTFLRPLLIHRMLLWDVTNYRTMANYAYSMLHHL 64 Query: 374 QNPD 385 PD Sbjct: 65 HIPD 68