BLASTX nr result
ID: Angelica23_contig00044803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00044803 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601481.1| hypothetical protein MTR_3g082160 [Medicago ... 76 3e-12 emb|CBI29873.3| unnamed protein product [Vitis vinifera] 69 4e-10 emb|CAN80644.1| hypothetical protein VITISV_016915 [Vitis vinifera] 69 4e-10 ref|XP_002526722.1| conserved hypothetical protein [Ricinus comm... 69 5e-10 ref|XP_002323310.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 >ref|XP_003601481.1| hypothetical protein MTR_3g082160 [Medicago truncatula] gi|355490529|gb|AES71732.1| hypothetical protein MTR_3g082160 [Medicago truncatula] Length = 351 Score = 75.9 bits (185), Expect = 3e-12 Identities = 33/65 (50%), Positives = 43/65 (66%) Frame = -3 Query: 197 EMMDENVPIKKLHWMNLCIKCDKGNGKLLNCRENDCPLVVHEGCLGFEAKFDEVGNFTCP 18 + + E VP+ L N+CI C+K G+LL C + DCP+ VH C+G E KFD+ GNF CP Sbjct: 57 DSVPETVPVDSLD-DNICITCNKLGGELLVCSQTDCPVSVHVTCIGSEPKFDDSGNFFCP 115 Query: 17 YCVYK 3 YC YK Sbjct: 116 YCAYK 120 >emb|CBI29873.3| unnamed protein product [Vitis vinifera] Length = 774 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -3 Query: 152 NLCIKCDKGNGKLLNCRENDCPLVVHEGCLGFEAKFDEVGNFTCPYCVY 6 NLC+KC K +G+LL C + CPLVVHE CLG FD +GNF CP+C Y Sbjct: 506 NLCMKCTK-DGQLLVCSSSGCPLVVHENCLGCPPSFDNMGNFYCPFCAY 553 >emb|CAN80644.1| hypothetical protein VITISV_016915 [Vitis vinifera] Length = 774 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -3 Query: 152 NLCIKCDKGNGKLLNCRENDCPLVVHEGCLGFEAKFDEVGNFTCPYCVY 6 NLC+KC K +G+LL C + CPLVVHE CLG FD +GNF CP+C Y Sbjct: 506 NLCMKCTK-DGQLLVCSSSGCPLVVHENCLGCPPSFDNMGNFYCPFCAY 553 >ref|XP_002526722.1| conserved hypothetical protein [Ricinus communis] gi|223533911|gb|EEF35636.1| conserved hypothetical protein [Ricinus communis] Length = 814 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = -3 Query: 155 MNLCIKCDKGNGKLLNCRENDCPLVVHEGCLGFEAKFDEVGNFTCPYCVY 6 +NLC++C K +G+LL C CP VVHE CLG KFDE GNF CP+C Y Sbjct: 466 LNLCVQCSK-DGQLLVCNAVGCPFVVHEKCLGCSPKFDEKGNFYCPFCAY 514 >ref|XP_002323310.1| predicted protein [Populus trichocarpa] gi|222867940|gb|EEF05071.1| predicted protein [Populus trichocarpa] Length = 827 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/49 (57%), Positives = 33/49 (67%) Frame = -3 Query: 152 NLCIKCDKGNGKLLNCRENDCPLVVHEGCLGFEAKFDEVGNFTCPYCVY 6 NLCIKC K +G+LL C C LV+HE CL F FDE G+F CP+C Y Sbjct: 489 NLCIKCCK-DGQLLVCGAGSCSLVIHENCLVFSPHFDERGDFYCPFCAY 536