BLASTX nr result
ID: Angelica23_contig00044802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00044802 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529689.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002529689.1| conserved hypothetical protein [Ricinus communis] gi|223530837|gb|EEF32700.1| conserved hypothetical protein [Ricinus communis] Length = 119 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/65 (40%), Positives = 38/65 (58%) Frame = +1 Query: 7 FTKCVFETDSKLLADAFNGGQGKSYFHSIVRDCVELSKHFKNVLVQFVHRSANVVAHSLA 186 F +C+ E+D+ + +A +S FH I+ DC L +HF+ V QFV RSAN A +A Sbjct: 35 FEECIIESDALQVIEALKAPSSQSCFHLIIDDCKHLVQHFRQVHFQFVRRSANTAAQIVA 94 Query: 187 RMPHS 201 R +S Sbjct: 95 RGAYS 99