BLASTX nr result
ID: Angelica23_contig00044427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00044427 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 62 6e-08 ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp.... 57 2e-06 ref|NP_001117603.1| conserved peptide upstream open reading fram... 56 3e-06 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] Length = 41 Score = 61.6 bits (148), Expect = 6e-08 Identities = 32/41 (78%), Positives = 34/41 (82%), Gaps = 3/41 (7%) Frame = +2 Query: 176 MSPVISEILCSGFMINTCLR---HLVQSFSVCFLYWFYDFS 289 MSPV+SEIL SGFMIN+ LR HLVQSFSV FLYWFY FS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297333431|gb|EFH63849.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/42 (71%), Positives = 33/42 (78%), Gaps = 3/42 (7%) Frame = +2 Query: 173 YMSPVISEILCSGFMINTCLR---HLVQSFSVCFLYWFYDFS 289 +MSPVISEIL SG I++ LR HLVQSFSV FLYWFY FS Sbjct: 12 FMSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 53 >ref|NP_001117603.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] gi|332197591|gb|AEE35712.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] Length = 41 Score = 55.8 bits (133), Expect = 3e-06 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 3/41 (7%) Frame = +2 Query: 176 MSPVISEILCSGFMINTCLR---HLVQSFSVCFLYWFYDFS 289 MSPVISEIL SG I++ LR HLVQSFSV FLYWFY FS Sbjct: 1 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 41