BLASTX nr result
ID: Angelica23_contig00044334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00044334 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004167937.1| PREDICTED: 65-kDa microtubule-associated pro... 74 1e-11 ref|XP_004150149.1| PREDICTED: 65-kDa microtubule-associated pro... 74 1e-11 ref|XP_002281677.1| PREDICTED: 65-kDa microtubule-associated pro... 71 8e-11 emb|CAN64202.1| hypothetical protein VITISV_016187 [Vitis vinifera] 71 8e-11 ref|XP_002521913.1| PLE, putative [Ricinus communis] gi|22353895... 70 1e-10 >ref|XP_004167937.1| PREDICTED: 65-kDa microtubule-associated protein 6-like [Cucumis sativus] Length = 600 Score = 73.9 bits (180), Expect = 1e-11 Identities = 38/51 (74%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = -1 Query: 152 MLAVGNTY-GVCTSNNFNILLRELEQIWCDIGESEADKDRMLLDLERECLE 3 MLAVG+ + V TS++ N LLREL+QIW DIGESEADKDRMLL+LERECLE Sbjct: 1 MLAVGSPFTSVRTSSSCNALLRELQQIWSDIGESEADKDRMLLELERECLE 51 >ref|XP_004150149.1| PREDICTED: 65-kDa microtubule-associated protein 6-like [Cucumis sativus] Length = 600 Score = 73.9 bits (180), Expect = 1e-11 Identities = 38/51 (74%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = -1 Query: 152 MLAVGNTY-GVCTSNNFNILLRELEQIWCDIGESEADKDRMLLDLERECLE 3 MLAVG+ + V TS++ N LLREL+QIW DIGESEADKDRMLL+LERECLE Sbjct: 1 MLAVGSPFTSVRTSSSCNALLRELQQIWSDIGESEADKDRMLLELERECLE 51 >ref|XP_002281677.1| PREDICTED: 65-kDa microtubule-associated protein 6 [Vitis vinifera] gi|297737577|emb|CBI26778.3| unnamed protein product [Vitis vinifera] Length = 599 Score = 71.2 bits (173), Expect = 8e-11 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = -1 Query: 152 MLAVGNTYGVCTSNNFNILLRELEQIWCDIGESEADKDRMLLDLERECLE 3 MLA+G+ V TS LLRELEQIW DIGESEA+KDRMLL+LERECLE Sbjct: 1 MLALGSPTSVRTSTTCGALLRELEQIWNDIGESEAEKDRMLLELERECLE 50 >emb|CAN64202.1| hypothetical protein VITISV_016187 [Vitis vinifera] Length = 601 Score = 71.2 bits (173), Expect = 8e-11 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = -1 Query: 152 MLAVGNTYGVCTSNNFNILLRELEQIWCDIGESEADKDRMLLDLERECLE 3 MLA+G+ V TS LLRELEQIW DIGESEA+KDRMLL+LERECLE Sbjct: 1 MLALGSPTSVRTSTTCGALLRELEQIWNDIGESEAEKDRMLLELERECLE 50 >ref|XP_002521913.1| PLE, putative [Ricinus communis] gi|223538951|gb|EEF40549.1| PLE, putative [Ricinus communis] Length = 600 Score = 70.5 bits (171), Expect = 1e-10 Identities = 36/51 (70%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = -1 Query: 152 MLAVGN-TYGVCTSNNFNILLRELEQIWCDIGESEADKDRMLLDLERECLE 3 MLA+G+ T V TS + N LLREL+QIW DIGE+EA+KDRMLL+LERECLE Sbjct: 1 MLAIGSPTISVRTSTSCNALLRELQQIWNDIGETEAEKDRMLLELERECLE 51