BLASTX nr result
ID: Angelica23_contig00044328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00044328 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510791.1| pentatricopeptide repeat-containing protein,... 129 2e-28 emb|CBI22748.3| unnamed protein product [Vitis vinifera] 125 4e-27 ref|XP_002268211.1| PREDICTED: pentatricopeptide repeat-containi... 125 4e-27 ref|XP_003571952.1| PREDICTED: pentatricopeptide repeat-containi... 119 3e-25 ref|XP_002894516.1| pentatricopeptide repeat-containing protein ... 119 3e-25 >ref|XP_002510791.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549906|gb|EEF51393.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 475 Score = 129 bits (324), Expect = 2e-28 Identities = 58/75 (77%), Positives = 69/75 (92%) Frame = -3 Query: 225 SARTFNIVICTCGQAGLARKTVERFVKLKSFSYRPFKHSFNAILYSLLTVKQYKLIEWVY 46 +ARTFNI+ICTCG AGLARK VERF+K K+F+YRPFKHS+NAIL SLL +++YKLIEWV+ Sbjct: 188 TARTFNILICTCGGAGLARKVVERFIKSKTFNYRPFKHSYNAILLSLLAIREYKLIEWVH 247 Query: 45 QQMLIEGYDPDTLTY 1 QQML+EGY PDTLTY Sbjct: 248 QQMLVEGYCPDTLTY 262 >emb|CBI22748.3| unnamed protein product [Vitis vinifera] Length = 518 Score = 125 bits (314), Expect = 4e-27 Identities = 56/75 (74%), Positives = 67/75 (89%) Frame = -3 Query: 225 SARTFNIVICTCGQAGLARKTVERFVKLKSFSYRPFKHSFNAILYSLLTVKQYKLIEWVY 46 +ARTF I+ICTCG+AGLAR+ VERFVK K+F+YRPFKHS+NAIL+ LL +KQYKL+EWVY Sbjct: 227 TARTFQILICTCGEAGLARRAVERFVKSKNFNYRPFKHSYNAILHCLLCLKQYKLVEWVY 286 Query: 45 QQMLIEGYDPDTLTY 1 QQML+E Y PD LTY Sbjct: 287 QQMLLEDYSPDILTY 301 >ref|XP_002268211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Vitis vinifera] Length = 514 Score = 125 bits (314), Expect = 4e-27 Identities = 56/75 (74%), Positives = 67/75 (89%) Frame = -3 Query: 225 SARTFNIVICTCGQAGLARKTVERFVKLKSFSYRPFKHSFNAILYSLLTVKQYKLIEWVY 46 +ARTF I+ICTCG+AGLAR+ VERFVK K+F+YRPFKHS+NAIL+ LL +KQYKL+EWVY Sbjct: 223 TARTFQILICTCGEAGLARRAVERFVKSKNFNYRPFKHSYNAILHCLLCLKQYKLVEWVY 282 Query: 45 QQMLIEGYDPDTLTY 1 QQML+E Y PD LTY Sbjct: 283 QQMLLEDYSPDILTY 297 >ref|XP_003571952.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Brachypodium distachyon] Length = 501 Score = 119 bits (298), Expect = 3e-25 Identities = 52/75 (69%), Positives = 68/75 (90%) Frame = -3 Query: 225 SARTFNIVICTCGQAGLARKTVERFVKLKSFSYRPFKHSFNAILYSLLTVKQYKLIEWVY 46 SARTF+++ICTCGQAGL R+ VERF+K SF+YRPF++SFNAIL++LLT++QY LIEWV+ Sbjct: 210 SARTFHLLICTCGQAGLRRRLVERFIKSSSFNYRPFRNSFNAILHTLLTIEQYSLIEWVH 269 Query: 45 QQMLIEGYDPDTLTY 1 Q+ML+EG+ PD LTY Sbjct: 270 QKMLMEGHSPDVLTY 284 >ref|XP_002894516.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297340358|gb|EFH70775.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 477 Score = 119 bits (297), Expect = 3e-25 Identities = 52/75 (69%), Positives = 67/75 (89%) Frame = -3 Query: 225 SARTFNIVICTCGQAGLARKTVERFVKLKSFSYRPFKHSFNAILYSLLTVKQYKLIEWVY 46 +A TFN++ICTCG+AGLAR VE+F+K K+F+YRP+KHS+NAIL+SLL VKQYKLI+WVY Sbjct: 186 TACTFNLLICTCGEAGLARDVVEQFIKSKTFNYRPYKHSYNAILHSLLGVKQYKLIDWVY 245 Query: 45 QQMLIEGYDPDTLTY 1 +QML +G+ PD LTY Sbjct: 246 EQMLEDGFSPDVLTY 260