BLASTX nr result
ID: Angelica23_contig00044200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00044200 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281981.1| PREDICTED: uncharacterized protein LOC100253... 72 5e-11 ref|XP_002313839.1| predicted protein [Populus trichocarpa] gi|2... 72 5e-11 emb|CAN63485.1| hypothetical protein VITISV_017086 [Vitis vinifera] 72 5e-11 ref|XP_002521862.1| conserved hypothetical protein [Ricinus comm... 71 8e-11 ref|XP_002330320.1| predicted protein [Populus trichocarpa] gi|2... 69 5e-10 >ref|XP_002281981.1| PREDICTED: uncharacterized protein LOC100253812 [Vitis vinifera] Length = 365 Score = 72.0 bits (175), Expect = 5e-11 Identities = 37/56 (66%), Positives = 43/56 (76%), Gaps = 4/56 (7%) Frame = -3 Query: 285 GSVGSRK----MSAHEWHYKVNRSVAEEMRKKTYLPYKQGFFGCLGFRVSGVHEIS 130 GSV S + +SAHE HY VNR+V+EEMR+KT+LPYKQG GCLGF S VHEIS Sbjct: 306 GSVSSSRRRGPVSAHEMHYTVNRAVSEEMRRKTFLPYKQGLLGCLGFN-STVHEIS 360 >ref|XP_002313839.1| predicted protein [Populus trichocarpa] gi|222850247|gb|EEE87794.1| predicted protein [Populus trichocarpa] Length = 375 Score = 72.0 bits (175), Expect = 5e-11 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 6/63 (9%) Frame = -3 Query: 282 SVGSRK-----MSAHEWHYKVNRSVAEEMRKKTYLPYKQGFFGCLGF-RVSGVHEISNRG 121 S+GS + +SAHE HY VNR+V+EEM++KT+LPYKQG GCLGF R + VHEIS RG Sbjct: 310 SIGSSRRRSGPISAHEVHYTVNRAVSEEMKRKTFLPYKQGLLGCLGFNRAASVHEIS-RG 368 Query: 120 IVS 112 + S Sbjct: 369 VRS 371 >emb|CAN63485.1| hypothetical protein VITISV_017086 [Vitis vinifera] Length = 366 Score = 72.0 bits (175), Expect = 5e-11 Identities = 37/56 (66%), Positives = 43/56 (76%), Gaps = 4/56 (7%) Frame = -3 Query: 285 GSVGSRK----MSAHEWHYKVNRSVAEEMRKKTYLPYKQGFFGCLGFRVSGVHEIS 130 GSV S + +SAHE HY VNR+V+EEMR+KT+LPYKQG GCLGF S VHEIS Sbjct: 307 GSVSSSRRRGPVSAHEMHYTVNRAVSEEMRRKTFLPYKQGLLGCLGFN-STVHEIS 361 >ref|XP_002521862.1| conserved hypothetical protein [Ricinus communis] gi|223538900|gb|EEF40498.1| conserved hypothetical protein [Ricinus communis] Length = 382 Score = 71.2 bits (173), Expect = 8e-11 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 288 GGSVGSR-KMSAHEWHYKVNRSVAEEMRKKTYLPYKQGFFGCLGFRVSGVHEISNRGIVS 112 GGS R +SAHE HY NR+V+EEM++KT+LPYKQG GCLGF GVHEIS RGI S Sbjct: 321 GGSSRRRGPVSAHELHYTANRAVSEEMKRKTFLPYKQGLLGCLGFN-PGVHEIS-RGIGS 378 >ref|XP_002330320.1| predicted protein [Populus trichocarpa] gi|222871355|gb|EEF08486.1| predicted protein [Populus trichocarpa] Length = 310 Score = 68.6 bits (166), Expect = 5e-10 Identities = 37/62 (59%), Positives = 46/62 (74%), Gaps = 5/62 (8%) Frame = -3 Query: 282 SVGSRK-----MSAHEWHYKVNRSVAEEMRKKTYLPYKQGFFGCLGFRVSGVHEISNRGI 118 SVGS + +SAHE HY VNR+V+EEMR+KT+LPYKQG GCLGF + HEI+ RG+ Sbjct: 248 SVGSARRRSGSISAHEVHYTVNRAVSEEMRRKTFLPYKQGLLGCLGF--NAAHEIA-RGV 304 Query: 117 VS 112 S Sbjct: 305 GS 306