BLASTX nr result
ID: Angelica23_contig00044088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00044088 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001894123.1| T-cell receptor beta chain ANA 11 [Brugia ma... 55 4e-06 >ref|XP_001894123.1| T-cell receptor beta chain ANA 11 [Brugia malayi] gi|158599424|gb|EDP37037.1| T-cell receptor beta chain ANA 11, putative [Brugia malayi] Length = 133 Score = 55.5 bits (132), Expect = 4e-06 Identities = 30/71 (42%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = +1 Query: 46 HIHTAI-AHLPTAIHTHSKTRTHITAEIQSSNRTYTREKDDSRWCFHRNRENSHTHTHTH 222 HIHT I H+ T IHTH+ T TH + TYT D+ H +HTHTHTH Sbjct: 53 HIHTQIYVHIYTHIHTHTHTHTHTHTHTHTHTHTYTHTHTDTHTHTH-----THTHTHTH 107 Query: 223 DAPLHATHAHT 255 TH HT Sbjct: 108 IHTQTHTHIHT 118