BLASTX nr result
ID: Angelica23_contig00043484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00043484 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAU84989.1| anthranilate synthase alpha 2 [Camptotheca acumin... 61 1e-07 >gb|AAU84989.1| anthranilate synthase alpha 2 [Camptotheca acuminata] Length = 579 Score = 60.8 bits (146), Expect = 1e-07 Identities = 36/75 (48%), Positives = 47/75 (62%) Frame = +1 Query: 79 MQALSISPRFFPSTQRKSLLPATSFSIGKCSISYPSLTLPVFPQCRAVQSPHQVADEVKF 258 MQ+L++S R PST S +PAT+ S S S SL + +C ++QSP V DE +F Sbjct: 1 MQSLAMSLRLSPSTHCLSPIPATAIS----SRSSGSLACVLSIKCCSLQSPSIVVDETRF 56 Query: 259 TEASQMGNLIPLHRC 303 EAS+ GNLIPLH C Sbjct: 57 LEASKKGNLIPLHAC 71