BLASTX nr result
ID: Angelica23_contig00043480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00043480 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32349.3| unnamed protein product [Vitis vinifera] 68 9e-10 ref|XP_002271834.1| PREDICTED: phosphate metabolism protein 7-li... 68 9e-10 gb|AAC79116.1| hypothetical protein [Arabidopsis thaliana] 60 2e-07 ref|NP_192199.1| ERD (early-responsive to dehydration stress) fa... 60 2e-07 ref|XP_002533077.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 >emb|CBI32349.3| unnamed protein product [Vitis vinifera] Length = 766 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/46 (69%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +3 Query: 3 TEPDLNLKMYLEDAYIHPIFKGGEYRRPN-IDEESDPIIVATKRNS 137 TEP+LNLK YL+DAYIHP+FKGGE+ RP IDEE + +VATKR+S Sbjct: 705 TEPNLNLKNYLQDAYIHPVFKGGEFERPEVIDEEENNPLVATKRSS 750 >ref|XP_002271834.1| PREDICTED: phosphate metabolism protein 7-like [Vitis vinifera] Length = 756 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/46 (69%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +3 Query: 3 TEPDLNLKMYLEDAYIHPIFKGGEYRRPN-IDEESDPIIVATKRNS 137 TEP+LNLK YL+DAYIHP+FKGGE+ RP IDEE + +VATKR+S Sbjct: 695 TEPNLNLKNYLQDAYIHPVFKGGEFERPEVIDEEENNPLVATKRSS 740 >gb|AAC79116.1| hypothetical protein [Arabidopsis thaliana] Length = 680 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/47 (57%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +3 Query: 3 TEPDLNLKMYLEDAYIHPIFKGGEYRRPN-IDEESDPIIVATKRNSR 140 TEP+LNLK YL+DAY+HP+FKG ++ RP +DEE +V TKR S+ Sbjct: 590 TEPNLNLKEYLKDAYVHPVFKGNDFDRPRVVDEEESNPLVRTKRTSQ 636 >ref|NP_192199.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis thaliana] gi|4263507|gb|AAD15333.1| hypothetical protein [Arabidopsis thaliana] gi|7269775|emb|CAB77775.1| hypothetical protein [Arabidopsis thaliana] gi|332656848|gb|AEE82248.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis thaliana] Length = 785 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/47 (57%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +3 Query: 3 TEPDLNLKMYLEDAYIHPIFKGGEYRRPN-IDEESDPIIVATKRNSR 140 TEP+LNLK YL+DAY+HP+FKG ++ RP +DEE +V TKR S+ Sbjct: 695 TEPNLNLKEYLKDAYVHPVFKGNDFDRPRVVDEEESNPLVRTKRTSQ 741 >ref|XP_002533077.1| conserved hypothetical protein [Ricinus communis] gi|223527141|gb|EEF29316.1| conserved hypothetical protein [Ricinus communis] Length = 756 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 2/48 (4%) Frame = +3 Query: 3 TEPDLNLKMYLEDAYIHPIFKGGEYRRPNI--DEESDPIIVATKRNSR 140 T+P LNL++YL DAY+HP+FKGGE+ RP I +EE+ P++ T+ + + Sbjct: 695 TDPTLNLRIYLHDAYVHPVFKGGEWDRPCIINEEENSPLVATTRTSQK 742