BLASTX nr result
ID: Angelica23_contig00043343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00043343 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530585.1| nascent polypeptide associated complex alpha... 67 2e-09 >ref|XP_002530585.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] gi|223529884|gb|EEF31815.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] Length = 687 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/88 (37%), Positives = 49/88 (55%) Frame = -2 Query: 265 SKNIFSGNRICLSQIVPKEAEVAAVPPTREAMESIFRRLFLYVIGSCFFGNSRSVIHYEL 86 S+ FS ++ L + P + P + +E +FRRL LY++GSCFF +I L Sbjct: 328 SEGFFSQGKLKLDVLCPLTLDFRKKPANSD-LEWMFRRLILYLVGSCFFSGPDMMIPIRL 386 Query: 85 VQFLEDIDAVGTYDWGAITYATFLAGMR 2 V + +I + YDWGA T++ FL GMR Sbjct: 387 VSAMSNIQKISQYDWGAATFSAFLRGMR 414