BLASTX nr result
ID: Angelica23_contig00042193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00042193 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_395468.1| putative coat protein [Blueberry red ringspot v... 55 8e-06 >ref|NP_395468.1| putative coat protein [Blueberry red ringspot virus] gi|16033535|gb|AAL13273.1|AF404509_3 putative coat protein [Blueberry red ringspot virus] Length = 486 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Frame = -3 Query: 267 ECKCWNCNEKGHYANKCPKLKEKGVKYINSSQFI-MNLEQIKEDNDKWYKYEDFYVSQTD 91 +CKCW C E GHYAN+CP ++ K Q +NLE I+ DN E+ + QTD Sbjct: 400 DCKCWICQEDGHYANECPNKDKRRDKVKLLEQLSQVNLEPIENDN---ISEEELWYLQTD 456 Query: 90 KDSESE 73 ++SE E Sbjct: 457 EESEEE 462