BLASTX nr result
ID: Angelica23_contig00041932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00041932 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634254.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_003540784.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 emb|CBI15095.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002321560.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 ref|XP_003539180.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 >ref|XP_003634254.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Vitis vinifera] Length = 450 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/60 (50%), Positives = 38/60 (63%) Frame = -3 Query: 180 QDXXXXXXXXXTDSKALPQTLQAHNINWTQDLVHKTLKRLWNHGPKALQFFNILDRHNSY 1 QD TDS+ L +TL+ + + WT +LV + LK LWNHGPKALQFF LD H +Y Sbjct: 38 QDATIVNLVLKTDSQTLTRTLEKYPVEWTPNLVDRVLKLLWNHGPKALQFFKSLDYHPTY 97 >ref|XP_003540784.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Glycine max] Length = 495 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = -3 Query: 144 DSKALPQTLQAHNINWTQDLVHKTLKRLWNHGPKALQFFNILDRHN 7 D + + + L I WT DLV+K +KRLWNHGPKALQFF LDRH+ Sbjct: 52 DPRTVSEALTKPTIQWTPDLVNKVMKRLWNHGPKALQFFKHLDRHH 97 >emb|CBI15095.3| unnamed protein product [Vitis vinifera] Length = 815 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/60 (50%), Positives = 38/60 (63%) Frame = -3 Query: 180 QDXXXXXXXXXTDSKALPQTLQAHNINWTQDLVHKTLKRLWNHGPKALQFFNILDRHNSY 1 QD TDS+ L +TL+ + + WT +LV + LK LWNHGPKALQFF LD H +Y Sbjct: 38 QDATIVNLVLKTDSQTLTRTLEKYPVEWTPNLVDRVLKLLWNHGPKALQFFKSLDYHPTY 97 >ref|XP_002321560.1| predicted protein [Populus trichocarpa] gi|222868556|gb|EEF05687.1| predicted protein [Populus trichocarpa] Length = 491 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -3 Query: 138 KALPQTLQAHNINWTQDLVHKTLKRLWNHGPKALQFFNILDRHNSY 1 +AL QTL + I WT LV+ LKRLWN GPKALQFFN+L H SY Sbjct: 52 QALAQTLHSPTIQWTPQLVNTILKRLWNDGPKALQFFNLLSHHPSY 97 >ref|XP_003539180.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Glycine max] Length = 492 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -3 Query: 144 DSKALPQTLQAHNINWTQDLVHKTLKRLWNHGPKALQFFNILDRH 10 D + L + L I+WT +LV+KTLKRLWNHGPKAL FF LDRH Sbjct: 49 DPRTLSEALTKPRIHWTPELVNKTLKRLWNHGPKALLFFKHLDRH 93