BLASTX nr result
ID: Angelica23_contig00041906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00041906 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17696.3| unnamed protein product [Vitis vinifera] 98 8e-19 ref|XP_002270991.1| PREDICTED: UPF0392 protein RCOM_0530710-like... 98 8e-19 ref|XP_002300081.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 ref|XP_002526929.1| conserved hypothetical protein [Ricinus comm... 87 1e-15 ref|XP_003555151.1| PREDICTED: UPF0392 protein RCOM_0530710-like... 75 4e-12 >emb|CBI17696.3| unnamed protein product [Vitis vinifera] Length = 1019 Score = 97.8 bits (242), Expect = 8e-19 Identities = 54/96 (56%), Positives = 62/96 (64%), Gaps = 7/96 (7%) Frame = +1 Query: 1 QSLEKMEESTS-------VFSPRFRSVAEMAGWDEETLLVASLVVEDTPDRQIKHKRRTD 159 QS EK ES VFSPRF+SVA +AGWDEE LL+ASLVVEDTPDR +KHK+R+D Sbjct: 624 QSPEKQSESVENDGSAECVFSPRFKSVAALAGWDEEALLIASLVVEDTPDRLVKHKKRSD 683 Query: 160 LHFKTPPPXXXXXXXXXXXXXXXXIPVTILDLDVGD 267 L FKT PP IPVT+LDLD G+ Sbjct: 684 LTFKT-PPSNSRRKRRTQRRSPASIPVTVLDLDEGE 718 >ref|XP_002270991.1| PREDICTED: UPF0392 protein RCOM_0530710-like [Vitis vinifera] Length = 908 Score = 97.8 bits (242), Expect = 8e-19 Identities = 54/96 (56%), Positives = 62/96 (64%), Gaps = 7/96 (7%) Frame = +1 Query: 1 QSLEKMEESTS-------VFSPRFRSVAEMAGWDEETLLVASLVVEDTPDRQIKHKRRTD 159 QS EK ES VFSPRF+SVA +AGWDEE LL+ASLVVEDTPDR +KHK+R+D Sbjct: 578 QSPEKQSESVENDGSAECVFSPRFKSVAALAGWDEEALLIASLVVEDTPDRLVKHKKRSD 637 Query: 160 LHFKTPPPXXXXXXXXXXXXXXXXIPVTILDLDVGD 267 L FKT PP IPVT+LDLD G+ Sbjct: 638 LTFKT-PPSNSRRKRRTQRRSPASIPVTVLDLDEGE 672 >ref|XP_002300081.1| predicted protein [Populus trichocarpa] gi|222847339|gb|EEE84886.1| predicted protein [Populus trichocarpa] Length = 915 Score = 90.1 bits (222), Expect = 2e-16 Identities = 44/84 (52%), Positives = 58/84 (69%) Frame = +1 Query: 7 LEKMEESTSVFSPRFRSVAEMAGWDEETLLVASLVVEDTPDRQIKHKRRTDLHFKTPPPX 186 ++ + ++FSPRF+SVA MAGWDEE++L ASL+VEDTP+RQ +HK+R+DLHFKTPP Sbjct: 592 VDNSQNMENLFSPRFKSVAAMAGWDEESILFASLIVEDTPERQFEHKKRSDLHFKTPP-- 649 Query: 187 XXXXXXXXXXXXXXXIPVTILDLD 258 IPV IL+LD Sbjct: 650 -STNTRRDQKKSPISIPVPILNLD 672 >ref|XP_002526929.1| conserved hypothetical protein [Ricinus communis] gi|223533681|gb|EEF35416.1| conserved hypothetical protein [Ricinus communis] Length = 400 Score = 87.0 bits (214), Expect = 1e-15 Identities = 37/59 (62%), Positives = 50/59 (84%) Frame = +1 Query: 4 SLEKMEESTSVFSPRFRSVAEMAGWDEETLLVASLVVEDTPDRQIKHKRRTDLHFKTPP 180 ++E + ++FSPRF+S+A MAGWDEE++L ASL+VEDTPDR KHK+R+DLHF+TPP Sbjct: 19 TVENGQNMDNMFSPRFKSLAAMAGWDEESILTASLIVEDTPDRLFKHKKRSDLHFQTPP 77 >ref|XP_003555151.1| PREDICTED: UPF0392 protein RCOM_0530710-like [Glycine max] Length = 937 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = +1 Query: 31 SVFSPRFRSVAEMAGWDEETLLVASLVVEDTPDRQIKHKRRTDLHFKTPP 180 ++FSPRF+S A MAGWDEE LL+ASL VEDTPDR KHK+R H KTPP Sbjct: 586 TLFSPRFKSAAAMAGWDEEALLLASLFVEDTPDRDPKHKKRYVWHSKTPP 635