BLASTX nr result
ID: Angelica23_contig00041889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00041889 (461 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514282.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002514282.1| conserved hypothetical protein [Ricinus communis] gi|223546738|gb|EEF48236.1| conserved hypothetical protein [Ricinus communis] Length = 261 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 103 FDKSLQELKDLRSQLHNAADYCQATFRNATHKHM 2 FDKSLQEL+DLRSQLH AADYC++TF NA K M Sbjct: 22 FDKSLQELRDLRSQLHYAADYCESTFLNAKEKKM 55