BLASTX nr result
ID: Angelica23_contig00041829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00041829 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510512.1| Myosin heavy chain, striated muscle, putativ... 55 8e-06 >ref|XP_002510512.1| Myosin heavy chain, striated muscle, putative [Ricinus communis] gi|223551213|gb|EEF52699.1| Myosin heavy chain, striated muscle, putative [Ricinus communis] Length = 1041 Score = 54.7 bits (130), Expect = 8e-06 Identities = 32/62 (51%), Positives = 36/62 (58%), Gaps = 5/62 (8%) Frame = -3 Query: 177 DTSESAAVPTASSG-----TXXXXXXXXXXXXXKYVQISVESYTHLTGLEDQVKLYEDEV 13 D +E AAV T S G + YVQISVESYTHLTGLEDQVK YE +V Sbjct: 14 DKTEKAAVATDSGGGGSLASSGSQADKDNYKKPNYVQISVESYTHLTGLEDQVKTYEQQV 73 Query: 12 KT 7 +T Sbjct: 74 QT 75