BLASTX nr result
ID: Angelica23_contig00041634
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00041634 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530585.1| nascent polypeptide associated complex alpha... 56 3e-06 >ref|XP_002530585.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] gi|223529884|gb|EEF31815.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] Length = 687 Score = 55.8 bits (133), Expect = 3e-06 Identities = 32/92 (34%), Positives = 46/92 (50%), Gaps = 5/92 (5%) Frame = -2 Query: 262 ERALELLG-----KPGAIRDGKIHLEKIKPDPREVSGIPPTDDVKEKLFRRLFLYVVSSC 98 E ++LLG G GK+ L+ + P + P D+ E +FRRL LY+V SC Sbjct: 315 EECIKLLGLVGTESEGFFSQGKLKLDVLCPLTLDFRKKPANSDL-EWMFRRLILYLVGSC 373 Query: 97 FFNNNRSVISHNLVECLERINEVGSYDWGQVT 2 FF+ +I LV + I ++ YDWG T Sbjct: 374 FFSGPDMMIPIRLVSAMSNIQKISQYDWGAAT 405