BLASTX nr result
ID: Angelica23_contig00041609
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00041609 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284890.1| PREDICTED: uncharacterized protein LOC100251... 63 2e-08 ref|XP_002514747.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002284890.1| PREDICTED: uncharacterized protein LOC100251924 [Vitis vinifera] gi|297733968|emb|CBI15215.3| unnamed protein product [Vitis vinifera] Length = 83 Score = 63.2 bits (152), Expect = 2e-08 Identities = 34/65 (52%), Positives = 46/65 (70%), Gaps = 1/65 (1%) Frame = +2 Query: 2 LSLNAVPLTRTRSLMHELH-GHAISEDNHLVHVEKRGKVKTVMGRMNLVQLNDYPGSGAN 178 + +NAVP+ RTR MH H GH +SE + L ++EK + + + RM+ +LNDYPGSGAN Sbjct: 18 ICVNAVPVARTRR-MHGYHQGHQVSEVSFLNNMEKIWEEQNIRARMD-AELNDYPGSGAN 75 Query: 179 NRHTP 193 NRHTP Sbjct: 76 NRHTP 80 >ref|XP_002514747.1| conserved hypothetical protein [Ricinus communis] gi|223546351|gb|EEF47853.1| conserved hypothetical protein [Ricinus communis] Length = 92 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/74 (40%), Positives = 41/74 (55%), Gaps = 3/74 (4%) Frame = +2 Query: 2 LSLNAVPLTRTRSLMHELHGHAISEDNHLVHVEKRGKVKTVMGRMNLVQLNDYPGSGANN 181 + LNA+P+TR L H +SE H+V +K + + +LNDYPGSGAN+ Sbjct: 19 ICLNAIPITRIGRLTHGPQVLTVSETTHMVAKDKNLEEHENLEERIAAELNDYPGSGANH 78 Query: 182 RHT---PRRGCIDC 214 RHT P+ C DC Sbjct: 79 RHTPWPPQLRCADC 92