BLASTX nr result
ID: Angelica23_contig00041511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00041511 (639 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19146.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_002284180.1| PREDICTED: TPR repeat-containing thioredoxin... 71 1e-10 ref|XP_003544787.1| PREDICTED: TPR repeat-containing thioredoxin... 71 2e-10 ref|XP_003543765.1| PREDICTED: TPR repeat-containing thioredoxin... 70 4e-10 ref|XP_003615062.1| Small glutamine-rich tetratricopeptide repea... 68 2e-09 >emb|CBI19146.3| unnamed protein product [Vitis vinifera] Length = 685 Score = 71.2 bits (173), Expect = 1e-10 Identities = 38/67 (56%), Positives = 48/67 (71%), Gaps = 3/67 (4%) Frame = +3 Query: 228 LSCLTYVCY---SLFKM*VEIEDNPYIMQLEDVNSVPAFKIYKNGSTIKEISGENFESLE 398 L L VC S++ + VE+ED+PY+ + E V+SVPAFKIYKNGS +KEI G N E LE Sbjct: 618 LQLLEQVCKRYPSVYFLKVEVEDHPYLAKSESVSSVPAFKIYKNGSRVKEIPGNNRELLE 677 Query: 399 SSVKMIS 419 SSVK+ S Sbjct: 678 SSVKLYS 684 >ref|XP_002284180.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Vitis vinifera] Length = 707 Score = 71.2 bits (173), Expect = 1e-10 Identities = 38/67 (56%), Positives = 48/67 (71%), Gaps = 3/67 (4%) Frame = +3 Query: 228 LSCLTYVCY---SLFKM*VEIEDNPYIMQLEDVNSVPAFKIYKNGSTIKEISGENFESLE 398 L L VC S++ + VE+ED+PY+ + E V+SVPAFKIYKNGS +KEI G N E LE Sbjct: 640 LQLLEQVCKRYPSVYFLKVEVEDHPYLAKSESVSSVPAFKIYKNGSRVKEIPGNNRELLE 699 Query: 399 SSVKMIS 419 SSVK+ S Sbjct: 700 SSVKLYS 706 >ref|XP_003544787.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 694 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +3 Query: 273 VEIEDNPYIMQLEDVNSVPAFKIYKNGSTIKEISGENFESLESSVKMIS 419 VEIED+PY+ + E V+S+PAFKIYKNGS++KEISG N E LE SVK+ S Sbjct: 645 VEIEDHPYLAKSESVSSIPAFKIYKNGSSVKEISGNNHELLERSVKLYS 693 >ref|XP_003543765.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 703 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = +3 Query: 273 VEIEDNPYIMQLEDVNSVPAFKIYKNGSTIKEISGENFESLESSVKMIS 419 VEIED+PY+ + E V+S+PAFKIYKNGS +KEISG N E LE SVK+ S Sbjct: 654 VEIEDHPYLAKSEGVSSIPAFKIYKNGSRVKEISGNNHELLERSVKLYS 702 >ref|XP_003615062.1| Small glutamine-rich tetratricopeptide repeat-containing protein [Medicago truncatula] gi|355516397|gb|AES98020.1| Small glutamine-rich tetratricopeptide repeat-containing protein [Medicago truncatula] Length = 676 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +3 Query: 273 VEIEDNPYIMQLEDVNSVPAFKIYKNGSTIKEISGENFESLESSVKMIS 419 VEIED+PY+ + E V+S PAFKIYKNGS +KEISG N E LE SVK S Sbjct: 627 VEIEDHPYLAKSEGVSSFPAFKIYKNGSRVKEISGNNHEFLEKSVKFYS 675