BLASTX nr result
ID: Angelica23_contig00040914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00040914 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531176.1| nucleic acid binding protein, putative [Rici... 59 5e-07 ref|XP_003632719.1| PREDICTED: uncharacterized protein LOC100267... 56 3e-06 emb|CAN68511.1| hypothetical protein VITISV_043839 [Vitis vinifera] 56 3e-06 ref|XP_002322740.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002309289.1| predicted protein [Populus trichocarpa] gi|2... 55 4e-06 >ref|XP_002531176.1| nucleic acid binding protein, putative [Ricinus communis] gi|223529246|gb|EEF31219.1| nucleic acid binding protein, putative [Ricinus communis] Length = 231 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -2 Query: 121 MERNEKETRDLMSVGSFSELPFIRPTLLKEKSIRLFGKEF 2 M+++E+ET D M+V SFS+LPFIRP +KEKSIRLFG EF Sbjct: 1 MDKSERETHDFMNVESFSQLPFIRPAPVKEKSIRLFGIEF 40 >ref|XP_003632719.1| PREDICTED: uncharacterized protein LOC100267595 [Vitis vinifera] Length = 238 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 109 EKETRDLMSVGSFSELPFIRPTLLKEKSIRLFGKEF 2 E+ET D M+V SFS+LPFIRP +KEK IRLFGKEF Sbjct: 6 ERETHDFMNVESFSQLPFIRPAPVKEKGIRLFGKEF 41 >emb|CAN68511.1| hypothetical protein VITISV_043839 [Vitis vinifera] Length = 270 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 109 EKETRDLMSVGSFSELPFIRPTLLKEKSIRLFGKEF 2 E+ET D M+V SFS+LPFIRP +KEK IRLFGKEF Sbjct: 38 ERETHDFMNVESFSQLPFIRPAPVKEKGIRLFGKEF 73 >ref|XP_002322740.1| predicted protein [Populus trichocarpa] gi|222867370|gb|EEF04501.1| predicted protein [Populus trichocarpa] Length = 233 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -2 Query: 121 MERNEKETRDLMSVGSFSELPFIRPTLLKEKSIRLFGKEF 2 M++ E+ET D M+V SFS+LPFIRP +KEK IRLFG EF Sbjct: 1 MDKVERETHDFMNVESFSQLPFIRPAPIKEKGIRLFGIEF 40 >ref|XP_002309289.1| predicted protein [Populus trichocarpa] gi|222855265|gb|EEE92812.1| predicted protein [Populus trichocarpa] Length = 215 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -2 Query: 121 MERNEKETRDLMSVGSFSELPFIRPTLLKEKSIRLFGKEF 2 M++ E+ET D M+V SFS+LPFIRP +KEK IRLFG EF Sbjct: 1 MDKVERETHDFMNVESFSQLPFIRPAPVKEKGIRLFGIEF 40