BLASTX nr result
ID: Angelica23_contig00040835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00040835 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533240.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 >ref|XP_002533240.1| conserved hypothetical protein [Ricinus communis] gi|223526938|gb|EEF29141.1| conserved hypothetical protein [Ricinus communis] Length = 219 Score = 58.9 bits (141), Expect = 4e-07 Identities = 30/84 (35%), Positives = 50/84 (59%), Gaps = 1/84 (1%) Frame = -3 Query: 342 LSDVSSHTLAKIRILGDVNARIQVFCITLPMVKVALECDITIDDRSLTVSN-AAHNIGAV 166 L +S + +++++GD+ ++++ +T+P +KVALECDI I+ L N N V Sbjct: 136 LQKKASKKVVQMKLIGDIRVQLRLLHLTMPKMKVALECDIGINYAELPFENYELFNKEVV 195 Query: 165 KTQLTSFPSYAQSFSSNCSIGLYI 94 + L S P + SFS NC++ LYI Sbjct: 196 QEHLASLPVNSGSFSKNCTLALYI 219