BLASTX nr result
ID: Angelica23_contig00040692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00040692 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269518.2| PREDICTED: survival of motor neuron-related-... 46 2e-07 >ref|XP_002269518.2| PREDICTED: survival of motor neuron-related-splicing factor 30-like [Vitis vinifera] Length = 301 Score = 46.2 bits (108), Expect(2) = 2e-07 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = -1 Query: 221 VIGLTEELLETAKQSEKSGLSLSGDADVSPSSHHNGGSIQHYLD 90 VI LTEELL TAKQSE S + +AD SP H +GGS +H ++ Sbjct: 49 VIVLTEELLATAKQSEISLPAFGTNADASPIQHQSGGSSEHLME 92 Score = 33.9 bits (76), Expect(2) = 2e-07 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -2 Query: 340 DDPRNSEYEDMEKELAEVCYMS 275 DDP NSEY DMEKEL EV ++ Sbjct: 32 DDPGNSEYVDMEKELEEVIVLT 53