BLASTX nr result
ID: Angelica23_contig00040561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00040561 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002329366.1| predicted protein [Populus trichocarpa] gi|3... 62 6e-08 ref|XP_002518326.1| lipoic acid synthetase, putative [Ricinus co... 61 8e-08 ref|NP_568196.1| lipoyl synthase [Arabidopsis thaliana] gi|30819... 61 8e-08 gb|AAM62684.1| lipoic acid synthase-like protein [Arabidopsis th... 61 8e-08 ref|XP_002319912.1| predicted protein [Populus trichocarpa] gi|3... 60 1e-07 >ref|XP_002329366.1| predicted protein [Populus trichocarpa] gi|308191448|sp|B9N2B0.1|LISC2_POPTR RecName: Full=Lipoyl synthase 2, chloroplastic; AltName: Full=Lipoate synthase 2; Short=LS 2; Short=Lip-syn 2; AltName: Full=Lipoate synthase, plastidial 2; Short=LIP1p 2; AltName: Full=Lipoic acid synthase 2; Flags: Precursor gi|222870416|gb|EEF07547.1| predicted protein [Populus trichocarpa] Length = 397 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 305 GFRYVASGPLVRSSYRAGELFVKTMVKESSQRNVA 201 GFRYVASGPLVRSSYRAGELFVKTMVKES++ A Sbjct: 361 GFRYVASGPLVRSSYRAGELFVKTMVKESAKEAAA 395 >ref|XP_002518326.1| lipoic acid synthetase, putative [Ricinus communis] gi|308197093|sp|B9RX57.1|LISC_RICCO RecName: Full=Lipoyl synthase, chloroplastic; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoate synthase, plastidial; Short=LIP1p; AltName: Full=Lipoic acid synthase; Flags: Precursor gi|223542546|gb|EEF44086.1| lipoic acid synthetase, putative [Ricinus communis] Length = 364 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 305 GFRYVASGPLVRSSYRAGELFVKTMVKESSQRNVAQ 198 GFRYVASGP+VRSSYRAGELFVKTMVKE S + A+ Sbjct: 328 GFRYVASGPMVRSSYRAGELFVKTMVKERSSNSAAK 363 >ref|NP_568196.1| lipoyl synthase [Arabidopsis thaliana] gi|308191548|sp|Q8LEE8.2|LISC_ARATH RecName: Full=Lipoyl synthase, chloroplastic; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoate synthase, plastidial; Short=LIP1p; AltName: Full=Lipoic acid synthase; Flags: Precursor gi|20373023|dbj|BAB91180.1| lipoic acid synthase [Arabidopsis thaliana] gi|98960967|gb|ABF58967.1| At5g08415 [Arabidopsis thaliana] gi|332003915|gb|AED91298.1| lipoyl synthase [Arabidopsis thaliana] Length = 394 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 305 GFRYVASGPLVRSSYRAGELFVKTMVKESSQRNVA 201 GFRYVASGPLVRSSYRAGELFVKTMVKES ++++ Sbjct: 360 GFRYVASGPLVRSSYRAGELFVKTMVKESYSKSLS 394 >gb|AAM62684.1| lipoic acid synthase-like protein [Arabidopsis thaliana] Length = 393 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 305 GFRYVASGPLVRSSYRAGELFVKTMVKESSQRNVA 201 GFRYVASGPLVRSSYRAGELFVKTMVKES ++++ Sbjct: 359 GFRYVASGPLVRSSYRAGELFVKTMVKESYSKSLS 393 >ref|XP_002319912.1| predicted protein [Populus trichocarpa] gi|308191445|sp|B9I666.1|LISC1_POPTR RecName: Full=Lipoyl synthase 1, chloroplastic; AltName: Full=Lipoate synthase 1; Short=LS 1; Short=Lip-syn 1; AltName: Full=Lipoate synthase, plastidial 1; Short=LIP1p 1; AltName: Full=Lipoic acid synthase 1; Flags: Precursor gi|222858288|gb|EEE95835.1| predicted protein [Populus trichocarpa] Length = 376 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 305 GFRYVASGPLVRSSYRAGELFVKTMVKESSQRNVA 201 GFRYVASGPLVRSSYRAGELFVKTMVKES + A Sbjct: 340 GFRYVASGPLVRSSYRAGELFVKTMVKESVKEAAA 374