BLASTX nr result
ID: Angelica23_contig00040431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00040431 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002333289.1| predicted protein [Populus trichocarpa] gi|2... 56 4e-06 emb|CAN65491.1| hypothetical protein VITISV_003157 [Vitis vinifera] 55 6e-06 >ref|XP_002333289.1| predicted protein [Populus trichocarpa] gi|222835888|gb|EEE74309.1| predicted protein [Populus trichocarpa] Length = 425 Score = 55.8 bits (133), Expect = 4e-06 Identities = 21/43 (48%), Positives = 32/43 (74%) Frame = +1 Query: 178 KPLTFTQREERRQKGLCFYCDDKFTKGHECKKPQTFLMVADDE 306 K L + + ++RR +G+CF CD+KFT GH+C+KP+ L+ DDE Sbjct: 277 KRLAWDEMQKRRSQGICFNCDEKFTPGHKCQKPRLLLLEGDDE 319 >emb|CAN65491.1| hypothetical protein VITISV_003157 [Vitis vinifera] Length = 1242 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/47 (51%), Positives = 33/47 (70%) Frame = +1 Query: 178 KPLTFTQREERRQKGLCFYCDDKFTKGHECKKPQTFLMVADDEACED 318 K LT ++ + RR+KG+CF CD+KF+ GH CKK L+V +DE ED Sbjct: 179 KRLTESELQARREKGICFKCDEKFSLGHRCKKELRVLLVHEDEREED 225