BLASTX nr result
ID: Angelica23_contig00040267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00040267 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_178689.1| hAT dimerisation domain-containing protein [Ara... 54 3e-10 dbj|BAB01787.1| Ac-like transposase [Arabidopsis thaliana] 50 9e-09 ref|NP_192758.1| TTF-type zinc finger protein with HAT dimerizat... 47 2e-08 tpg|DAA63001.1| TPA: hypothetical protein ZEAMMB73_683256 [Zea m... 45 6e-08 ref|NP_179586.1| hAT dimerisation domain-containing protein / tr... 49 6e-08 >ref|NP_178689.1| hAT dimerisation domain-containing protein [Arabidopsis thaliana] gi|4584355|gb|AAD25149.1| Ac-like transposase [Arabidopsis thaliana] gi|330250914|gb|AEC06008.1| hAT dimerisation domain-containing protein [Arabidopsis thaliana] Length = 582 Score = 53.9 bits (128), Expect(2) = 3e-10 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = -1 Query: 217 MEGNYPNAWISYRSLITIIVTIAYAEQSFSKLKLTFNHV 101 +EG YPN WIS+R L+TI+V++A AE+SFSKLKL N++ Sbjct: 498 VEGCYPNTWISFRILLTILVSVASAERSFSKLKLIKNYL 536 Score = 35.4 bits (80), Expect(2) = 3e-10 Identities = 15/26 (57%), Positives = 24/26 (92%) Frame = -2 Query: 114 RSTMSEERLSGSAMLSIKKDMVQKLD 37 RSTMS++RL+G A+LSI++ M++K+D Sbjct: 537 RSTMSQDRLNGLAILSIERAMLEKID 562 >dbj|BAB01787.1| Ac-like transposase [Arabidopsis thaliana] Length = 667 Score = 50.1 bits (118), Expect(2) = 9e-09 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = -1 Query: 217 MEGNYPNAWISYRSLITIIVTIAYAEQSFSKLKLTFNHV 101 M+G YPN WI+YR L+TI V+IA AE++F KLKL N++ Sbjct: 546 MDGCYPNTWITYRILLTIPVSIASAERTFPKLKLIKNYL 584 Score = 34.3 bits (77), Expect(2) = 9e-09 Identities = 14/26 (53%), Positives = 24/26 (92%) Frame = -2 Query: 114 RSTMSEERLSGSAMLSIKKDMVQKLD 37 RST+ +ERL+G A++SI++++V+KLD Sbjct: 585 RSTVPQERLNGLALISIEQELVKKLD 610 >ref|NP_192758.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] gi|4538984|emb|CAB39772.1| putative protein [Arabidopsis thaliana] gi|7267716|emb|CAB78143.1| putative protein [Arabidopsis thaliana] gi|332657454|gb|AEE82854.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] Length = 733 Score = 47.4 bits (111), Expect(2) = 2e-08 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = -1 Query: 214 EGNYPNAWISYRSLITIIVTIAYAEQSFSKLKL 116 EG YPN WI++R ++T+ V++A AE+SFSKLKL Sbjct: 645 EGCYPNTWIAFRVMLTVPVSVASAERSFSKLKL 677 Score = 36.2 bits (82), Expect(2) = 2e-08 Identities = 17/26 (65%), Positives = 23/26 (88%) Frame = -2 Query: 114 RSTMSEERLSGSAMLSIKKDMVQKLD 37 RSTMSEERL+ A+LSI++D+V +LD Sbjct: 683 RSTMSEERLNALAILSIERDLVGELD 708 >tpg|DAA63001.1| TPA: hypothetical protein ZEAMMB73_683256 [Zea mays] Length = 938 Score = 45.1 bits (105), Expect(2) = 6e-08 Identities = 21/35 (60%), Positives = 28/35 (80%) Frame = -1 Query: 205 YPNAWISYRSLITIIVTIAYAEQSFSKLKLTFNHV 101 YPN ++YR L+TI VT+A AE+SFSKLKL N++ Sbjct: 859 YPNVTVAYRILLTIPVTVASAERSFSKLKLLKNYL 893 Score = 36.6 bits (83), Expect(2) = 6e-08 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -2 Query: 114 RSTMSEERLSGSAMLSIKKDMVQKLD 37 RSTMS+ERL+G AM SI+KD+V +D Sbjct: 894 RSTMSQERLNGLAMCSIEKDIVDTVD 919 >ref|NP_179586.1| hAT dimerisation domain-containing protein / transposase-related protein [Arabidopsis thaliana] gi|4580475|gb|AAD24399.1| Ac-like transposase [Arabidopsis thaliana] gi|20197289|gb|AAM15013.1| Ac-like transposase [Arabidopsis thaliana] gi|330251855|gb|AEC06949.1| hAT dimerisation domain-containing protein / transposase-related protein [Arabidopsis thaliana] Length = 173 Score = 49.3 bits (116), Expect(2) = 6e-08 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = -1 Query: 217 MEGNYPNAWISYRSLITIIVTIAYAEQSFSKLKL 116 +EG YPN+WI+Y+ L+TI V++A AE+SFSKLKL Sbjct: 91 VEGCYPNSWIAYQVLLTIPVSVASAERSFSKLKL 124 Score = 32.3 bits (72), Expect(2) = 6e-08 Identities = 15/28 (53%), Positives = 24/28 (85%) Frame = -2 Query: 114 RSTMSEERLSGSAMLSIKKDMVQKLDCE 31 RS+MS+ERLS A+LSI++ +V+++D E Sbjct: 130 RSSMSQERLSDLAILSIERALVREVDFE 157