BLASTX nr result
ID: Angelica23_contig00040234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00040234 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530294.1| structural constituent of cell wall, putativ... 55 6e-06 >ref|XP_002530294.1| structural constituent of cell wall, putative [Ricinus communis] gi|223530192|gb|EEF32101.1| structural constituent of cell wall, putative [Ricinus communis] Length = 335 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/69 (43%), Positives = 39/69 (56%), Gaps = 1/69 (1%) Frame = -2 Query: 204 QGSGKDPANKYDVKKPLPGTSQVRAVCKTKGACFQTTLTCPSQ-XXXXXXXXXXXXXCFI 28 QG+G D + +D +PL T Q RA CK KGAC++ TL CP+Q C + Sbjct: 25 QGAGNDKSEDFDEAEPLK-TGQERARCKAKGACYKKTLECPAQCPNKKPHKNKKQKGCHV 83 Query: 27 NCGSKCEAT 1 +C SKCEAT Sbjct: 84 DCSSKCEAT 92