BLASTX nr result
ID: Angelica23_contig00040208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00040208 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA36225.1| transposase [Ipomoea purpurea] 95 5e-18 ref|XP_003629505.1| Zinc finger MYM-type protein [Medicago trunc... 94 1e-17 ref|XP_003614463.1| 52 kDa repressor of the inhibitor of the pro... 94 1e-17 ref|XP_003602139.1| 52 kDa repressor of the inhibitor of the pro... 94 1e-17 ref|XP_003598405.1| 52 kDa repressor of the inhibitor of the pro... 93 2e-17 >dbj|BAA36225.1| transposase [Ipomoea purpurea] Length = 808 Score = 95.1 bits (235), Expect = 5e-18 Identities = 49/103 (47%), Positives = 73/103 (70%) Frame = +1 Query: 4 ASKKEISVWLFFSKLSAIINLIGCSPKWHT*LHSAQAIEIARMVTSGERDTGRGINQIGN 183 +SK+ I V FF+KL++IIN++G S K + L +A A I+ +++ E ++GRG+NQIG+ Sbjct: 412 SSKEVIPVHQFFTKLNSIINVVGASCKRNDQLKAAHASNISHLLSIDELESGRGLNQIGS 471 Query: 184 LHRSGSTRWSSHFDSIFSLIDMYGATISVLESIVEEGTSSSLR 312 L R G TRWSSH SI SL+ M+ AT VL +I+E+GT+ + R Sbjct: 472 LQRPGDTRWSSHLKSISSLMRMFSATCEVLLNIIEDGTTHAHR 514 >ref|XP_003629505.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355523527|gb|AET03981.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 821 Score = 93.6 bits (231), Expect = 1e-17 Identities = 47/103 (45%), Positives = 68/103 (66%) Frame = +1 Query: 4 ASKKEISVWLFFSKLSAIINLIGCSPKWHT*LHSAQAIEIARMVTSGERDTGRGINQIGN 183 AS++ S+ FF KL ++N++G S K H L +AQ+ EI ++ +GE TG+G NQ+G Sbjct: 477 ASREVASIHKFFEKLIFVVNVVGSSTKRHDELQAAQSKEIENLLETGEIVTGKGKNQVGT 536 Query: 184 LHRSGSTRWSSHFDSIFSLIDMYGATISVLESIVEEGTSSSLR 312 + R+G TRW SHF+SI SLI MYGAT VL+ I ++ + R Sbjct: 537 VKRAGDTRWGSHFNSICSLISMYGATCPVLKIIAKDAKKIAQR 579 >ref|XP_003614463.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355515798|gb|AES97421.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] Length = 796 Score = 93.6 bits (231), Expect = 1e-17 Identities = 47/103 (45%), Positives = 69/103 (66%) Frame = +1 Query: 4 ASKKEISVWLFFSKLSAIINLIGCSPKWHT*LHSAQAIEIARMVTSGERDTGRGINQIGN 183 AS++ S+ FF KL+ ++N++G S K H L +AQA EI ++ +GE TG+G NQ+G Sbjct: 394 ASREVASIHKFFKKLTFVVNVVGSSTKRHDELQAAQAKEIENLLETGEIVTGKGKNQVGT 453 Query: 184 LHRSGSTRWSSHFDSIFSLIDMYGATISVLESIVEEGTSSSLR 312 + R+G TRW SHF+SI SLI MY AT +VL+ I ++ + R Sbjct: 454 VKRAGDTRWGSHFNSICSLISMYEATCTVLKIIAKDAKKFAQR 496 >ref|XP_003602139.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355491187|gb|AES72390.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] Length = 785 Score = 93.6 bits (231), Expect = 1e-17 Identities = 47/103 (45%), Positives = 69/103 (66%) Frame = +1 Query: 4 ASKKEISVWLFFSKLSAIINLIGCSPKWHT*LHSAQAIEIARMVTSGERDTGRGINQIGN 183 AS++ S+ FF KL+ ++N++G S K H L +AQA EI ++ +GE TG+G NQ+G Sbjct: 383 ASREVASIHKFFEKLTFVVNVVGSSTKRHDELQAAQAKEIENLLETGEIVTGKGKNQVGT 442 Query: 184 LHRSGSTRWSSHFDSIFSLIDMYGATISVLESIVEEGTSSSLR 312 + R+G TRW SHF+SI SLI MY AT +VL+ I ++ + R Sbjct: 443 VKRAGDTRWGSHFNSICSLISMYEATCTVLKIIAKDAKKFAQR 485 >ref|XP_003598405.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|358348356|ref|XP_003638213.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355487453|gb|AES68656.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355504148|gb|AES85351.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] Length = 822 Score = 93.2 bits (230), Expect = 2e-17 Identities = 47/103 (45%), Positives = 68/103 (66%) Frame = +1 Query: 4 ASKKEISVWLFFSKLSAIINLIGCSPKWHT*LHSAQAIEIARMVTSGERDTGRGINQIGN 183 AS++ S+ FF KL+ ++N++G S K H L +AQA EI ++ +GE TG+G NQ+G Sbjct: 420 ASREVASIHKFFEKLTFVVNVVGSSTKRHDELQAAQAKEIENLLETGEIVTGKGKNQVGT 479 Query: 184 LHRSGSTRWSSHFDSIFSLIDMYGATISVLESIVEEGTSSSLR 312 + R G TRW SHF+SI SLI MY AT +VL+ I ++ + R Sbjct: 480 VKRDGDTRWGSHFNSICSLISMYEATCTVLKIIAKDAKKFAQR 522