BLASTX nr result
ID: Angelica23_contig00040117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00040117 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_192510.1| protease-associated (PA) domain-containing prot... 65 7e-09 ref|XP_003517636.1| PREDICTED: probable glutamate carboxypeptida... 65 7e-09 ref|NP_001190685.1| protease-associated (PA) domain-containing p... 65 7e-09 ref|XP_002871904.1| peptidase M28 family protein [Arabidopsis ly... 63 3e-08 ref|NP_197475.2| Peptidase M28 family protein [Arabidopsis thali... 63 3e-08 >ref|NP_192510.1| protease-associated (PA) domain-containing protein [Arabidopsis thaliana] gi|4773917|gb|AAD29787.1|AF147259_10 similar to human prostate-specific membrane antigen (PSM) (SP:Q04609) [Arabidopsis thaliana] gi|7267364|emb|CAB81137.1| putative peptidase [Arabidopsis thaliana] gi|332657175|gb|AEE82575.1| protease-associated (PA) domain-containing protein [Arabidopsis thaliana] Length = 280 Score = 64.7 bits (156), Expect = 7e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 212 ADRLGKLQKKGWKPRRTIIFCNWDAEEYGLVS 117 A RL KLQK+GWKPRRTII CNWDAEEYGLVS Sbjct: 216 AQRLDKLQKRGWKPRRTIILCNWDAEEYGLVS 247 >ref|XP_003517636.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Glycine max] Length = 693 Score = 64.7 bits (156), Expect = 7e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 212 ADRLGKLQKKGWKPRRTIIFCNWDAEEYGLV 120 A RLGKLQKKGW+PRRTI+ CNWDAEEYGL+ Sbjct: 369 AQRLGKLQKKGWRPRRTILLCNWDAEEYGLI 399 >ref|NP_001190685.1| protease-associated (PA) domain-containing protein [Arabidopsis thaliana] gi|332657176|gb|AEE82576.1| protease-associated (PA) domain-containing protein [Arabidopsis thaliana] Length = 245 Score = 64.7 bits (156), Expect = 7e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 212 ADRLGKLQKKGWKPRRTIIFCNWDAEEYGLVS 117 A RL KLQK+GWKPRRTII CNWDAEEYGLVS Sbjct: 181 AQRLDKLQKRGWKPRRTIILCNWDAEEYGLVS 212 >ref|XP_002871904.1| peptidase M28 family protein [Arabidopsis lyrata subsp. lyrata] gi|297317741|gb|EFH48163.1| peptidase M28 family protein [Arabidopsis lyrata subsp. lyrata] Length = 682 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 212 ADRLGKLQKKGWKPRRTIIFCNWDAEEYGLV 120 A RL KLQK+GWKPRRTII CNWDAEEYGL+ Sbjct: 354 AQRLDKLQKRGWKPRRTIILCNWDAEEYGLI 384 >ref|NP_197475.2| Peptidase M28 family protein [Arabidopsis thaliana] gi|30725320|gb|AAP37682.1| At5g19740 [Arabidopsis thaliana] gi|332005361|gb|AED92744.1| Peptidase M28 family protein [Arabidopsis thaliana] Length = 681 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 212 ADRLGKLQKKGWKPRRTIIFCNWDAEEYGLV 120 A RL KLQK+GWKPRRTII CNWDAEEYGL+ Sbjct: 355 AQRLDKLQKRGWKPRRTIILCNWDAEEYGLI 385