BLASTX nr result
ID: Angelica23_contig00040066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00040066 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532967.1| nutrient reservoir, putative [Ricinus commun... 57 2e-06 >ref|XP_002532967.1| nutrient reservoir, putative [Ricinus communis] gi|223527260|gb|EEF29418.1| nutrient reservoir, putative [Ricinus communis] Length = 134 Score = 57.0 bits (136), Expect = 2e-06 Identities = 37/98 (37%), Positives = 42/98 (42%), Gaps = 6/98 (6%) Frame = -3 Query: 313 ATDSPLVKLDHKAETGPVIHDVSIKCGECPCVNXXXXXXXXXXXXXXXXXXXXXXXPNAP 134 A S KLD P D IKCG CPCVN P Sbjct: 19 AATSVTKKLDQTLVPQPQEPDAGIKCGSCPCVNPCAQLPPPPPPPP-------------P 65 Query: 133 PPPRFIYFS--GPPPPRFVYFAGPPG-GDLY---PVEN 38 PPP+ +Y + PPPPRF+Y G PG G+LY P EN Sbjct: 66 PPPKTVYCTPLAPPPPRFIYVTGVPGNGNLYVTDPYEN 103