BLASTX nr result
ID: Angelica23_contig00039366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00039366 (395 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003629505.1| Zinc finger MYM-type protein [Medicago trunc... 135 3e-30 ref|XP_003614463.1| 52 kDa repressor of the inhibitor of the pro... 131 6e-29 ref|XP_003602139.1| 52 kDa repressor of the inhibitor of the pro... 131 6e-29 dbj|BAA36225.1| transposase [Ipomoea purpurea] 130 1e-28 ref|XP_003598405.1| 52 kDa repressor of the inhibitor of the pro... 128 5e-28 >ref|XP_003629505.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355523527|gb|AET03981.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 821 Score = 135 bits (341), Expect = 3e-30 Identities = 68/134 (50%), Positives = 86/134 (64%), Gaps = 5/134 (3%) Frame = +1 Query: 4 LERDPGRRRPIWKYSPNDRDDIRREYIRLGPCQPRLRKEDYPPTTFGSQRRRFQESWFNT 183 LERDPG+R PIWKY P D IRR Y++ GP Q L E+YP + G +RRFQ SWF+ Sbjct: 141 LERDPGKRIPIWKYPPKQMDAIRRAYLKWGPYQSNL--ENYPMSGIGKAQRRFQHSWFSL 198 Query: 184 F-TWLEYSVSKDAAFCFPCFLFEKDASSQH---AFTINGFRCWKRVDDNERCAFLVHIG- 348 F +WLEYS SKDAA+C C+LF S +H F GFR W++V + E C+FL HIG Sbjct: 199 FSSWLEYSPSKDAAYCLQCYLFSNKPSGRHGSEVFISIGFRSWRKVRNGENCSFLKHIGK 258 Query: 349 GCNSPHKKALKSLE 390 SPH A+K+ + Sbjct: 259 DPRSPHNNAMKACQ 272 >ref|XP_003614463.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355515798|gb|AES97421.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] Length = 796 Score = 131 bits (329), Expect = 6e-29 Identities = 65/135 (48%), Positives = 88/135 (65%), Gaps = 5/135 (3%) Frame = +1 Query: 1 TLERDPGRRRPIWKYSPNDRDDIRREYIRLGPCQPRLRKEDYPPTTFGSQRRRFQESWFN 180 +LERDPG+R PI++Y PN +D IRR Y++ GP Q L E+YP + G +RRFQ SWF+ Sbjct: 59 SLERDPGKRIPIYQYPPNQKDAIRRAYLKWGPYQSNL--ENYPMSGIGKAQRRFQHSWFS 116 Query: 181 TF-TWLEYSVSKDAAFCFPCFLFEKDASSQ---HAFTINGFRCWKRVDDNERCAFLVHIG 348 F +WLEYS S+DAA+C C+LF S + F GFR W++V + E C+FL HIG Sbjct: 117 LFSSWLEYSPSEDAAYCLQCYLFSNKPSGRPGSEVFISTGFRSWRKVRNGENCSFLKHIG 176 Query: 349 -GCNSPHKKALKSLE 390 SPH A+K+ + Sbjct: 177 KDPRSPHNNAMKACQ 191 >ref|XP_003602139.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355491187|gb|AES72390.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] Length = 785 Score = 131 bits (329), Expect = 6e-29 Identities = 65/135 (48%), Positives = 88/135 (65%), Gaps = 5/135 (3%) Frame = +1 Query: 1 TLERDPGRRRPIWKYSPNDRDDIRREYIRLGPCQPRLRKEDYPPTTFGSQRRRFQESWFN 180 +LERDPG+R PI++Y PN +D IRR Y++ GP Q L E+YP + G +RRFQ SWF+ Sbjct: 22 SLERDPGKRIPIYQYPPNQKDAIRRAYLKWGPYQSNL--ENYPMSGIGKAQRRFQHSWFS 79 Query: 181 TF-TWLEYSVSKDAAFCFPCFLFEKDASSQ---HAFTINGFRCWKRVDDNERCAFLVHIG 348 F +WLEYS S+DAA+C C+LF S + F GFR W++V + E C+FL HIG Sbjct: 80 LFSSWLEYSPSEDAAYCLQCYLFSNKPSGRPGSEVFISTGFRSWRKVRNGENCSFLKHIG 139 Query: 349 -GCNSPHKKALKSLE 390 SPH A+K+ + Sbjct: 140 KDPRSPHNNAMKACQ 154 >dbj|BAA36225.1| transposase [Ipomoea purpurea] Length = 808 Score = 130 bits (326), Expect = 1e-28 Identities = 70/131 (53%), Positives = 82/131 (62%), Gaps = 4/131 (3%) Frame = +1 Query: 4 LERDPGRRRPIWKYSPNDRDDIRREYIRLGPCQPRLRKEDYPPTTFGSQRRRFQESWFNT 183 LERDPG R PIWK RD++RR YI+ GP Q L K P + R FQ SWF Sbjct: 55 LERDPGLRLPIWKCPIEKRDEVRRAYIKAGPYQCLLSKY---PKSGEKHPRSFQASWFKL 111 Query: 184 F-TWLEYSVSKDAAFCFPCFLF--EKDASSQHAFTINGFRCWKRVDDNERCAFLVHIG-G 351 F +WLEYS SKDAAFC PC+LF + S AFTINGFR WK+V D + C+FL HIG Sbjct: 112 FPSWLEYSPSKDAAFCLPCYLFHTQDGPSGLDAFTINGFRSWKKVRDGKNCSFLAHIGKD 171 Query: 352 CNSPHKKALKS 384 SPH+ A K+ Sbjct: 172 LTSPHRNAEKA 182 >ref|XP_003598405.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|358348356|ref|XP_003638213.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355487453|gb|AES68656.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355504148|gb|AES85351.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] Length = 822 Score = 128 bits (321), Expect = 5e-28 Identities = 64/135 (47%), Positives = 87/135 (64%), Gaps = 5/135 (3%) Frame = +1 Query: 1 TLERDPGRRRPIWKYSPNDRDDIRREYIRLGPCQPRLRKEDYPPTTFGSQRRRFQESWFN 180 +LERDPG+ PI++Y PN +D IRR Y++ GP Q L E+YP + G +RRFQ SWF+ Sbjct: 59 SLERDPGKCIPIYQYPPNQKDAIRRAYLKWGPYQSNL--ENYPMSGIGKAQRRFQNSWFS 116 Query: 181 TF-TWLEYSVSKDAAFCFPCFLFEKDASSQ---HAFTINGFRCWKRVDDNERCAFLVHIG 348 F +WLEYS S+DAA+C C+LF S + F GFR W++V + E C+FL HIG Sbjct: 117 LFSSWLEYSPSEDAAYCLQCYLFSNKPSGRLGSEVFISTGFRSWRKVRNGENCSFLKHIG 176 Query: 349 -GCNSPHKKALKSLE 390 SPH A+K+ + Sbjct: 177 KDPRSPHNNAMKACQ 191