BLASTX nr result
ID: Angelica23_contig00039182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00039182 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79811.1| hypothetical protein VITISV_018821 [Vitis vinifera] 62 4e-08 ref|XP_003544373.1| PREDICTED: pentatricopeptide repeat-containi... 61 8e-08 ref|XP_002515835.1| pentatricopeptide repeat-containing protein,... 60 1e-07 ref|XP_002271725.2| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 emb|CBI40338.3| unnamed protein product [Vitis vinifera] 60 2e-07 >emb|CAN79811.1| hypothetical protein VITISV_018821 [Vitis vinifera] Length = 871 Score = 62.4 bits (150), Expect = 4e-08 Identities = 37/79 (46%), Positives = 50/79 (63%), Gaps = 5/79 (6%) Frame = +3 Query: 57 FSTSTLPTKKWSP-----KSLLSAKQTHQQHIVRGLANTDPITIISIYTHSDSHNHAIKL 221 FST++ T S KSL SA+ THQQ +V+GL + DP IIS+Y +S A+ + Sbjct: 41 FSTASSTTDLTSTLFHQCKSLASAELTHQQLLVQGLPH-DPTHIISMYLTFNSPAKALSV 99 Query: 222 LERLSPSSSAVYWWNELIK 278 L RL PSS V+WWN+LI+ Sbjct: 100 LRRLHPSSHTVFWWNQLIR 118 >ref|XP_003544373.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860-like [Glycine max] Length = 986 Score = 61.2 bits (147), Expect = 8e-08 Identities = 38/84 (45%), Positives = 50/84 (59%), Gaps = 2/84 (2%) Frame = +3 Query: 60 STSTLP-TKKWSPKSLLSAKQTHQQHIVRGLANTDPITIISIYTHSDSHNHAIKLLERLS 236 S +T+P T SL AK HQQ I++GL +I Y S+S +AI LLERL Sbjct: 159 SCATIPITALKECNSLAHAKLLHQQSIMQGLLFHLATNLIGTYIASNSTAYAILLLERLP 218 Query: 237 PSSSAVYWWNELIKTRLPF-SPKD 305 PS S+V+WWN+LI+ L SP+D Sbjct: 219 PSPSSVFWWNQLIRRALHLGSPRD 242 >ref|XP_002515835.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544990|gb|EEF46504.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 655 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/68 (44%), Positives = 43/68 (63%) Frame = +3 Query: 75 PTKKWSPKSLLSAKQTHQQHIVRGLANTDPITIISIYTHSDSHNHAIKLLERLSPSSSAV 254 PT KS+ + HQQ IV+GL + + +IS Y ++ +HA+ LL+ L+PS SAV Sbjct: 45 PTLLKQCKSIFQSHLIHQQAIVQGLLSHFSLNLISTYLALNAPSHALSLLQCLTPSPSAV 104 Query: 255 YWWNELIK 278 YWWN LI+ Sbjct: 105 YWWNALIR 112 >ref|XP_002271725.2| PREDICTED: pentatricopeptide repeat-containing protein At5g16860-like [Vitis vinifera] Length = 852 Score = 60.1 bits (144), Expect = 2e-07 Identities = 36/79 (45%), Positives = 49/79 (62%), Gaps = 5/79 (6%) Frame = +3 Query: 57 FSTSTLPTKKWSP-----KSLLSAKQTHQQHIVRGLANTDPITIISIYTHSDSHNHAIKL 221 FST++ T S KSL SA+ HQQ +V+GL + DP IIS+Y +S A+ + Sbjct: 22 FSTASSTTDLTSTLFHQCKSLASAELIHQQLLVQGLPH-DPTHIISMYLTFNSPAKALSV 80 Query: 222 LERLSPSSSAVYWWNELIK 278 L RL PSS V+WWN+LI+ Sbjct: 81 LRRLHPSSHTVFWWNQLIR 99 >emb|CBI40338.3| unnamed protein product [Vitis vinifera] Length = 487 Score = 60.1 bits (144), Expect = 2e-07 Identities = 36/79 (45%), Positives = 49/79 (62%), Gaps = 5/79 (6%) Frame = +3 Query: 57 FSTSTLPTKKWSP-----KSLLSAKQTHQQHIVRGLANTDPITIISIYTHSDSHNHAIKL 221 FST++ T S KSL SA+ HQQ +V+GL + DP IIS+Y +S A+ + Sbjct: 22 FSTASSTTDLTSTLFHQCKSLASAELIHQQLLVQGLPH-DPTHIISMYLTFNSPAKALSV 80 Query: 222 LERLSPSSSAVYWWNELIK 278 L RL PSS V+WWN+LI+ Sbjct: 81 LRRLHPSSHTVFWWNQLIR 99