BLASTX nr result
ID: Angelica23_contig00039121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00039121 (366 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278014.2| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 dbj|BAH19478.1| AT2G06000 [Arabidopsis thaliana] 54 1e-05 ref|NP_178657.1| pentatricopeptide repeat-containing protein [Ar... 54 1e-05 >ref|XP_002278014.2| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vitis vinifera] Length = 641 Score = 57.4 bits (137), Expect = 1e-06 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 3/93 (3%) Frame = +2 Query: 95 SRVQRVSEIAAIAGFHSH-VPLESHPSQHLETV--WFIKVLCTLCVRTSPSLQIFKSQYF 265 SRV R S+IA IA FH H V + + + ++ W +KV+CTLCVRT SL YF Sbjct: 43 SRV-RASKIA-IAQFHEHAVGISRNRPEVIQNPENWIVKVICTLCVRTH-SLDAC-LDYF 98 Query: 266 EKNLNPFLAFEVIKQVNFSFRNPKLAFGFFQFT 364 K L P +AFEV++ +N NP+LA FFQ + Sbjct: 99 SKTLTPSIAFEVVRGLN----NPELALKFFQLS 127 >dbj|BAH19478.1| AT2G06000 [Arabidopsis thaliana] Length = 536 Score = 54.3 bits (129), Expect = 1e-05 Identities = 32/95 (33%), Positives = 52/95 (54%), Gaps = 9/95 (9%) Frame = +2 Query: 107 RVSEIAAIAGFHSHV-------PLESHPSQ--HLETVWFIKVLCTLCVRTSPSLQIFKSQ 259 R + AIA FH+H PL+++ + H W +K++ TL V P + Sbjct: 3 RTTFATAIAHFHTHSHGGAQARPLQNNTREVIHCPEAWLVKIVSTLFVYRVPDSDLCFC- 61 Query: 260 YFEKNLNPFLAFEVIKQVNFSFRNPKLAFGFFQFT 364 Y KNLNPF++FEV+K+++ NP + F F++F+ Sbjct: 62 YLSKNLNPFISFEVVKKLD---NNPHIGFRFWEFS 93 >ref|NP_178657.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|42570711|ref|NP_973429.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75216767|sp|Q9ZUE9.1|PP149_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g06000 gi|4006835|gb|AAC95177.1| hypothetical protein [Arabidopsis thaliana] gi|110736272|dbj|BAF00106.1| hypothetical protein [Arabidopsis thaliana] gi|330250896|gb|AEC05990.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|330250897|gb|AEC05991.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 536 Score = 54.3 bits (129), Expect = 1e-05 Identities = 32/95 (33%), Positives = 52/95 (54%), Gaps = 9/95 (9%) Frame = +2 Query: 107 RVSEIAAIAGFHSHV-------PLESHPSQ--HLETVWFIKVLCTLCVRTSPSLQIFKSQ 259 R + AIA FH+H PL+++ + H W +K++ TL V P + Sbjct: 3 RTTFATAIAHFHTHSHGGAQARPLQNNTREVIHCPEAWLVKIVSTLFVYRVPDSDLCFC- 61 Query: 260 YFEKNLNPFLAFEVIKQVNFSFRNPKLAFGFFQFT 364 Y KNLNPF++FEV+K+++ NP + F F++F+ Sbjct: 62 YLSKNLNPFISFEVVKKLD---NNPHIGFRFWEFS 93