BLASTX nr result
ID: Angelica23_contig00038400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00038400 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_564704.2| zinc ion binding protein [Arabidopsis thaliana]... 59 5e-07 ref|XP_002891861.1| zinc ion binding protein [Arabidopsis lyrata... 58 7e-07 gb|AAF79318.1|AC002304_11 F14J16.17 [Arabidopsis thaliana] 57 1e-06 ref|XP_002522770.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 ref|XP_003551472.1| PREDICTED: uncharacterized protein LOC100795... 57 2e-06 >ref|NP_564704.2| zinc ion binding protein [Arabidopsis thaliana] gi|110738098|dbj|BAF00982.1| hypothetical protein [Arabidopsis thaliana] gi|119935912|gb|ABM06032.1| At1g55915 [Arabidopsis thaliana] gi|332195198|gb|AEE33319.1| zinc ion binding protein [Arabidopsis thaliana] Length = 404 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -2 Query: 353 LHELCHNAHGPHNALFYKLWDALRKVAPSFLS 258 LHELCHNAHGPHNA FYKLWD LRK +S Sbjct: 97 LHELCHNAHGPHNASFYKLWDELRKECEELMS 128 >ref|XP_002891861.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] gi|297337703|gb|EFH68120.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] Length = 401 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -2 Query: 353 LHELCHNAHGPHNALFYKLWDALRKVAPSFLS 258 LHELCHNAHGPHNA FYKLWD LRK +S Sbjct: 94 LHELCHNAHGPHNANFYKLWDELRKECEELMS 125 >gb|AAF79318.1|AC002304_11 F14J16.17 [Arabidopsis thaliana] Length = 450 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = -2 Query: 353 LHELCHNAHGPHNALFYKLWDALRK 279 LHELCHNAHGPHNA FYKLWD LRK Sbjct: 151 LHELCHNAHGPHNASFYKLWDELRK 175 >ref|XP_002522770.1| conserved hypothetical protein [Ricinus communis] gi|223538008|gb|EEF39621.1| conserved hypothetical protein [Ricinus communis] Length = 404 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -2 Query: 353 LHELCHNAHGPHNALFYKLWDALRKVAPSFLS 258 LHELCHN HGPHNA FYKLWD LRK LS Sbjct: 93 LHELCHNVHGPHNANFYKLWDELRKECEELLS 124 >ref|XP_003551472.1| PREDICTED: uncharacterized protein LOC100795976 [Glycine max] Length = 409 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = -2 Query: 353 LHELCHNAHGPHNALFYKLWDALRK 279 LHELCHNAHGPHNA FYKLWD LRK Sbjct: 94 LHELCHNAHGPHNANFYKLWDELRK 118