BLASTX nr result
ID: Angelica23_contig00038197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00038197 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF46300.1| GPI-anchored protein [Ipomoea nil] 54 2e-09 ref|NP_200428.1| LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 [Arabidopsi... 54 2e-09 ref|XP_002864439.1| hypothetical protein ARALYDRAFT_495704 [Arab... 53 3e-08 ref|XP_003570483.1| PREDICTED: GPI-anchored protein LORELEI-like... 52 2e-07 ref|XP_002531773.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >dbj|BAF46300.1| GPI-anchored protein [Ipomoea nil] Length = 170 Score = 53.5 bits (127), Expect(2) = 2e-09 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 85 GRNLLQSKKACPITFEFQNYTIITSQCK 2 GR+LLQ+KKACP+ FE QNYT+ITSQCK Sbjct: 41 GRSLLQAKKACPVNFEVQNYTVITSQCK 68 Score = 33.1 bits (74), Expect(2) = 2e-09 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = -3 Query: 189 CCSFCKILLISISVLVDFSTSTFISDGIFESPVSKDATCFSQRK 58 C SF LL+S+S+ FS+S+ ISDG+F S S + +K Sbjct: 8 CLSF--FLLLSLSLFAGFSSSSSISDGVFVSQSSTGRSLLQAKK 49 >ref|NP_200428.1| LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 [Arabidopsis thaliana] gi|9758637|dbj|BAB09299.1| unnamed protein product [Arabidopsis thaliana] gi|23306374|gb|AAN17414.1| putative protein [Arabidopsis thaliana] gi|24899659|gb|AAN65044.1| putative protein [Arabidopsis thaliana] gi|332009346|gb|AED96729.1| LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 [Arabidopsis thaliana] Length = 168 Score = 54.3 bits (129), Expect(2) = 2e-09 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 97 SCLQGRNLLQSKKACPITFEFQNYTIITSQCK 2 S + GRNLLQ+KK CP+ FEF NYTIITS+CK Sbjct: 35 SLVLGRNLLQTKKTCPVNFEFMNYTIITSKCK 66 Score = 32.3 bits (72), Expect(2) = 2e-09 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = -3 Query: 156 ISVLVDFSTSTFISDGIFES 97 +SVL FS+S+FISDG+FES Sbjct: 14 LSVLSSFSSSSFISDGVFES 33 >ref|XP_002864439.1| hypothetical protein ARALYDRAFT_495704 [Arabidopsis lyrata subsp. lyrata] gi|297310274|gb|EFH40698.1| hypothetical protein ARALYDRAFT_495704 [Arabidopsis lyrata subsp. lyrata] Length = 169 Score = 53.1 bits (126), Expect(2) = 3e-08 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -2 Query: 85 GRNLLQSKKACPITFEFQNYTIITSQCK 2 GRNLLQ+KK CP+ FEF NYT+ITS+CK Sbjct: 40 GRNLLQTKKTCPVNFEFMNYTVITSKCK 67 Score = 29.6 bits (65), Expect(2) = 3e-08 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -3 Query: 165 LISISVLVDFSTSTFISDGIFES 97 L+ + L FS+S+FISDG+FES Sbjct: 12 LLLSTTLSSFSSSSFISDGVFES 34 >ref|XP_003570483.1| PREDICTED: GPI-anchored protein LORELEI-like isoform 1 [Brachypodium distachyon] gi|357137794|ref|XP_003570484.1| PREDICTED: GPI-anchored protein LORELEI-like isoform 2 [Brachypodium distachyon] Length = 166 Score = 51.6 bits (122), Expect(2) = 2e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -2 Query: 85 GRNLLQSKKACPITFEFQNYTIITSQCK 2 GR+LLQ+KK+CP+ FEFQNY IIT QCK Sbjct: 40 GRSLLQAKKSCPVNFEFQNYKIITDQCK 67 Score = 28.5 bits (62), Expect(2) = 2e-07 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 171 ILLISISVLVDF-STSTFISDGIFESPVSKDATCFSQRK 58 +LL S +VL F S S FISDG+F++ Q K Sbjct: 9 LLLFSAAVLAAFASASPFISDGVFQASAGSTGRSLLQAK 47 >ref|XP_002531773.1| conserved hypothetical protein [Ricinus communis] gi|223528609|gb|EEF30629.1| conserved hypothetical protein [Ricinus communis] Length = 149 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -2 Query: 85 GRNLLQSKKACPITFEFQNYTIITSQCK 2 GRNLLQ+KKACP+ FEFQNYTIITSQCK Sbjct: 46 GRNLLQAKKACPVNFEFQNYTIITSQCK 73