BLASTX nr result
ID: Angelica23_contig00038131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00038131 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278897.1| PREDICTED: pentatricopeptide repeat-containi... 46 1e-09 ref|XP_003525595.1| PREDICTED: pentatricopeptide repeat-containi... 48 3e-07 >ref|XP_002278897.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vitis vinifera] Length = 719 Score = 45.8 bits (107), Expect(2) = 1e-09 Identities = 21/40 (52%), Positives = 27/40 (67%) Frame = -3 Query: 348 SNIYAAEGRWDDVDKVRRRMVEKGFQKAAGSSVFQVGDPG 229 SNIYAAEG+WDDV+ VR+ M E+G K G S + + G Sbjct: 563 SNIYAAEGKWDDVEIVRKMMKERGLTKTTGFSWVHIEEFG 602 Score = 41.6 bits (96), Expect(2) = 1e-09 Identities = 18/29 (62%), Positives = 25/29 (86%) Frame = -2 Query: 226 ESFEVKGSVHKRSMVYSMLSDMGTQIKMS 140 +SF K SVH++SM+YS+LSDM TQ+K+S Sbjct: 604 QSFVEKASVHRKSMMYSILSDMATQMKLS 632 >ref|XP_003525595.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Glycine max] Length = 595 Score = 48.1 bits (113), Expect(2) = 3e-07 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = -3 Query: 348 SNIYAAEGRWDDVDKVRRRMVEKGFQKAAGSSVFQVGD 235 SN+YAA+GRWDDV+ VR + EKG QK A SS+ + D Sbjct: 514 SNMYAAKGRWDDVEHVRLMIKEKGLQKEAASSLVHLED 551 Score = 31.2 bits (69), Expect(2) = 3e-07 Identities = 15/33 (45%), Positives = 24/33 (72%), Gaps = 4/33 (12%) Frame = -2 Query: 226 ESFEVK----GSVHKRSMVYSMLSDMGTQIKMS 140 E FE K S +++ ++YSMLS++GTQ+K+S Sbjct: 550 EDFESKYVKNNSGYRKKIMYSMLSELGTQMKLS 582