BLASTX nr result
ID: Angelica23_contig00037902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00037902 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513427.1| pentatricopeptide repeat-containing protein,... 67 2e-09 ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 gb|ADN33755.1| pentatricopeptide repeat-containing protein [Cucu... 63 3e-08 ref|XP_004162287.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-08 ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 >ref|XP_002513427.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547335|gb|EEF48830.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 567 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -3 Query: 201 LVEGMVHEGEKDLAVMVMKELHLRQVIGQSTIERLVMQYDLE 76 LVEG++HE EK+LA V++ELHLRQV+ QST+ERL+MQYDLE Sbjct: 522 LVEGIIHEEEKELAAEVLRELHLRQVMSQSTVERLIMQYDLE 563 >ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 201 LVEGMVHEGEKDLAVMVMKELHLRQVIGQSTIERLVMQYDLEKL 70 LVEG++HE E DLA V++EL LR VI QST+ERLVMQYDL +L Sbjct: 521 LVEGIIHEKEMDLATEVLRELQLRDVINQSTVERLVMQYDLNEL 564 >gb|ADN33755.1| pentatricopeptide repeat-containing protein [Cucumis melo subsp. melo] Length = 566 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 201 LVEGMVHEGEKDLAVMVMKELHLRQVIGQSTIERLVMQYDLEKL 70 LVEG++HE E DLA V++EL LR VI QST+ERLVMQYDL +L Sbjct: 521 LVEGIIHEKEMDLATKVLRELQLRDVISQSTLERLVMQYDLNEL 564 >ref|XP_004162287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -3 Query: 201 LVEGMVHEGEKDLAVMVMKELHLRQVIGQSTIERLVMQYDLEKL 70 LVEG++HE E DLA V++EL LR VI QST+ERL+MQYDL +L Sbjct: 521 LVEGIIHEKEMDLATEVLRELQLRDVINQSTVERLIMQYDLNEL 564 >ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Vitis vinifera] gi|147852271|emb|CAN82234.1| hypothetical protein VITISV_038804 [Vitis vinifera] Length = 567 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -3 Query: 201 LVEGMVHEGEKDLAVMVMKELHLRQVIGQSTIERLVMQYDLEKL 70 +VEG+ H+ E +LA V+KEL+LRQ +G+ST+ERLVMQYDLE L Sbjct: 522 IVEGIAHQEEMELAAAVLKELYLRQAVGRSTLERLVMQYDLEGL 565